Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

1 accessions found for   

Data for CP000112  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_1.hmm [HisKA]
Sequence database: CP000112.Gprot.fsa
per-sequence score cutoff: >= 26.8 [TC1]
per-domain score cutoff: >= 26.8 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA
Accession: PF00512.12
Description: His Kinase A (phosphoacceptor) domain
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000112_2922 CDS_2910399-2908579 100.4 3.8e-28 1
CP000112_0544 CDS_557035-559980 96.7 4.2e-27 1
CP000112_2764 CDS_2769649-2771970 90.7 2.2e-25 1
CP000112_0370 CDS_364720-361508 90.5 2.4e-25 1
CP000112_1941 CDS_1997002-1994972 90.3 2.8e-25 1
CP000112_1693 CDS_1752553-1749830 87.9 1.4e-24 1
CP000112_1360 CDS_1376596-1379520 87.5 1.7e-24 1
CP000112_1520 CDS_1542259-1543893 83.4 2.5e-23 1
CP000112_3773 CDS_3725959-3727779 81.1 1.1e-22 1
CP000112_0257 CDS_242278-239735 80.9 1.3e-22 1
CP000112_1937 CDS_1990442-1989255 79.5 3.1e-22 1
CP000112_0535 CDS_545639-543099 79.5 3.2e-22 1
CP000112_3590 CDS_3554573-3556012 74.1 1.1e-20 1
CP000112_1680 CDS_1736281-1738026 62.8 1.7e-17 2
CP000112_0878 CDS_906511-909033 60.8 6.3e-17 1
CP000112_3527 CDS_3492760-3493992 58.6 2.6e-16 1
CP000112_0505 CDS_513384-511888 54.6 3.6e-15 1
CP000112_0602 CDS_624475-626610 52.8 1.2e-14 1
CP000112_2820 CDS_2813573-2811936 52.6 1.3e-14 1
CP000112_0110 CDS_103510-101732 52.3 1.7e-14 1
CP000112_1286 CDS_1306641-1303078 50.7 4.5e-14 1
CP000112_2993 CDS_2984054-2986255 49.9 7.7e-14 1
CP000112_2366 CDS_2391639-2394026 47.2 4.5e-13 1
CP000112_0696 CDS_711243-709531 46.5 7.1e-13 1
CP000112_3199 CDS_3196236-3194950 42.6 9.4e-12 1
CP000112_0239 CDS_223266-224963 42.2 1.2e-11 1
CP000112_3710 CDS_3680346-3677866 40.7 3.2e-11 1
CP000112_3226 CDS_3221869-3225324 39.2 8.3e-11 2
CP000112_0558 CDS_582744-580453 38.0 1.8e-10 1
CP000112_0711 CDS_730245-728137 36.5 4.8e-10 1
CP000112_1261 CDS_1277497-1275533 34.3 2.1e-09 1
CP000112_1071 CDS_1096568-1098976 34.2 2.1e-09 1
CP000112_0758 CDS_783280-785682 33.8 2.8e-09 1
CP000112_2826 CDS_2818097-2820334 32.4 7.2e-09 2
CP000112_2943 CDS_2928725-2930857 31.4 1.3e-08 1
CP000112_3031 CDS_3027853-3025544 31.1 1.7e-08 1
CP000112_2944 CDS_2930891-2932747 29.1 5.9e-08 1
CP000112_0320 CDS_309353-311083 27.1 2.3e-07 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000112_2922 1/1 230 295 .. 1 87 [] 100.4 3.8e-28
CP000112_0544 1/1 268 333 .. 1 87 [] 96.7 4.2e-27
CP000112_2764 1/1 387 452 .. 1 87 [] 90.7 2.2e-25
CP000112_0370 1/1 528 593 .. 1 87 [] 90.5 2.4e-25
CP000112_1941 1/1 565 630 .. 1 87 [] 90.3 2.8e-25
CP000112_1693 1/1 379 444 .. 1 87 [] 87.9 1.4e-24
CP000112_1360 1/1 466 531 .. 1 87 [] 87.5 1.7e-24
CP000112_1520 1/1 167 232 .. 1 87 [] 83.4 2.5e-23
CP000112_3773 1/1 375 442 .. 1 87 [] 81.1 1.1e-22
CP000112_0257 1/1 460 525 .. 1 87 [] 80.9 1.3e-22
CP000112_1937 1/1 158 223 .. 1 87 [] 79.5 3.1e-22
CP000112_0535 1/1 707 772 .. 1 87 [] 79.5 3.2e-22
CP000112_3590 1/1 261 328 .. 1 87 [] 74.1 1.1e-20
CP000112_1680 1/2 349 415 .. 1 87 [] 62.4 2.2e-17
CP000112_0878 1/1 614 679 .. 1 87 [] 60.8 6.3e-17
CP000112_3527 1/1 169 244 .. 1 87 [] 58.6 2.6e-16
CP000112_0505 1/1 275 341 .. 1 87 [] 54.6 3.6e-15
CP000112_0602 1/1 443 509 .. 1 87 [] 52.8 1.2e-14
CP000112_2820 1/1 314 382 .. 1 87 [] 52.6 1.3e-14
CP000112_0110 1/1 366 432 .. 1 87 [] 52.3 1.7e-14
CP000112_1286 1/1 452 517 .. 1 87 [] 50.7 4.5e-14
CP000112_2993 1/1 515 584 .. 1 87 [] 49.9 7.7e-14
CP000112_2366 1/1 427 493 .. 1 87 [] 47.2 4.5e-13
CP000112_0696 1/1 330 404 .. 1 87 [] 46.5 7.1e-13
CP000112_3199 1/1 200 266 .. 1 87 [] 42.6 9.4e-12
CP000112_0239 1/1 302 392 .. 1 87 [] 42.2 1.2e-11
CP000112_3710 1/1 586 657 .. 1 87 [] 40.7 3.2e-11
CP000112_0558 1/1 511 601 .. 1 87 [] 38.0 1.8e-10
CP000112_3226 2/2 785 851 .. 1 87 [] 37.8 2.2e-10
CP000112_0711 1/1 437 515 .. 1 87 [] 36.5 4.8e-10
CP000112_1261 1/1 268 334 .. 1 87 [] 34.3 2.1e-09
CP000112_1071 1/1 523 613 .. 1 87 [] 34.2 2.1e-09
CP000112_0758 1/1 536 626 .. 1 87 [] 33.8 2.8e-09
CP000112_2943 1/1 445 535 .. 1 87 [] 31.4 1.3e-08
CP000112_3031 1/1 517 607 .. 1 87 [] 31.1 1.7e-08
CP000112_2944 1/1 389 460 .. 1 87 [] 29.1 5.9e-08
CP000112_0320 1/1 348 420 .. 1 87 [] 27.1 2.3e-07

Alignments of top-scoring domains:
CP000112_2922: domain 1 of 1, from 230 to 295: score 100.4, E = 3.8e-28
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aksefla++sHE+RTP+++++g+++l+ + t l+eeq
CP000112_2 230 AKSEFLASMSHEIRTPMNGVLGMLDLAMT---------TSLDEEQ-- 265

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
reyle ++++ae ll+Lind+Ld+s+ieag
CP000112_2 266 ----------REYLEAVQNSAEALLSLINDILDFSKIEAG 295

CP000112_0544: domain 1 of 1, from 268 to 333: score 96.7, E = 4.2e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++f+a++sHELRTP++aI+g++e++l+ tel+ +q
CP000112_0 268 AKGDFVASMSHELRTPMNAIIGMIEIALK---------TELTVKQ-- 303

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
reyl +i+++a++ll +nd+Ld+s+iea+
CP000112_0 304 ----------REYLTIIRSSARSLLGVVNDILDISKIEAQ 333

CP000112_2764: domain 1 of 1, from 387 to 452: score 90.7, E = 2.2e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fla++sHE+RTP+++++g+ae +l+ t+ls+eq
CP000112_2 387 AKSDFLAHMSHEIRTPMNSVLGMAEQMLR---------TPLSAEQ-- 422

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e +++++++e+ll+Lind+Ldl+r e g
CP000112_2 423 ----------KECMDVLKNSGESLLHLINDILDLTRVEGG 452

CP000112_0370: domain 1 of 1, from 528 to 593: score 90.5, E = 2.4e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aksefla +sHE RTPL+a+ g+a+lL e ++l+++q
CP000112_0 528 AKSEFLARMSHEVRTPLNAVVGMADLLWE---------SDLTPDQ-- 563

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r y+++ +++++ ll+L+nd+Ld+sr+eag
CP000112_0 564 ----------RLYVDIFRKSGQTLLALLNDILDYSRLEAG 593

CP000112_1941: domain 1 of 1, from 565 to 630: score 90.3, E = 2.8e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+efla +sHE+RTP++a++g+++l+l+ t+l+++q
CP000112_1 565 AKGEFLARMSHEIRTPMNAVIGMCHLALK---------TALTPKQ-- 600

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+yl +i+++a++ll ind+Ld+s+ieag
CP000112_1 601 ----------FDYLTKIQSSANSLLGVINDVLDFSKIEAG 630

CP000112_1693: domain 1 of 1, from 379 to 444: score 87.9, E = 1.4e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+eflan+sHE+RTP++aI+g++e++l+ tels++q
CP000112_1 379 AKGEFLANISHEFRTPMNAIIGMSEVILK---------TELSAPQ-- 414

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r l ++ ++a++ll+L+n +Ld+sr e+g
CP000112_1 415 ----------RNHLTVLNKAAHSLLDLLNTILDFSRYESG 444

CP000112_1360: domain 1 of 1, from 466 to 531: score 87.5, E = 1.7e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+kseflan+sHE+RTPL+aI+g++el l ++l+e
CP000112_1 466 SKSEFLANMSHEIRTPLNAIIGLTELSLQ---------EDLPEGV-- 501

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e l+ l++ae ll+++nd+Ldl+r e+g
CP000112_1 502 ----------GENLRASLSSAEALLDIVNDILDLARVESG 531

CP000112_1520: domain 1 of 1, from 167 to 232: score 83.4, E = 2.5e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+flan+sHELRTPL++I+g+++lLl ++++ ++
CP000112_1 167 AKSQFLANMSHELRTPLNGIIGLTDLLLC---------APAGGDH-- 202

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
reyle ++++++ ll ++n+lLd+s iea
CP000112_1 203 ----------REYLEMVKQAGQELLTIVNNLLDMSSIEAC 232

CP000112_3773: domain 1 of 1, from 375 to 442: score 81.1, E = 1.1e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+an+sHEL+TPLt+I+gy+e+L e +++++ eq+
CP000112_3 375 VRRDFVANVSHELKTPLTSIKGYTEMLIE--------SPPAGREQN- 412

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+l+til+ a+++ +++n lL l+r+++
CP000112_3 413 ----------SMFLQTILKNANHMIKMVNSLLVLARAQHK 442

CP000112_0257: domain 1 of 1, from 460 to 525: score 80.9, E = 1.3e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks fla++sHE+RTPL++++g++++L + + +++
CP000112_0 460 AKSAFLATMSHEIRTPLNGVLGMLQILGN---------EITDPKP-- 495

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++t+l++++ ll++ind+Ld+s i+ag
CP000112_0 496 ----------LRLTRTALDSGRKLLAIINDILDFSTIDAG 525

CP000112_1937: domain 1 of 1, from 158 to 223: score 79.5, E = 3.1e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+ flan+sHELRTPL++++g+a+lL t +s eq
CP000112_1 158 AKTVFLANVSHELRTPLNGVLGMAQLLSS---------TSMSGEQ-- 193

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +l +++++a rl +L++d+L+ s +eag
CP000112_1 194 ----------RYLLASLKQSAGRLGSLVSDILEHSSLEAG 223

CP000112_0535: domain 1 of 1, from 707 to 772: score 79.5, E = 3.2e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f+an+sHELRTPL++I+g ++++l +++ee+
CP000112_0 707 LKSQFVANISHELRTPLSGILGITDVMLG---------RPQPEET-- 742

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r l i++ ae l+ +nd+Ld+sr+eag
CP000112_0 743 ----------RSHLGMIRSVAEALRLVVNDILDFSRLEAG 772

CP000112_3590: domain 1 of 1, from 261 to 328: score 74.1, E = 1.1e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++++a+++HE+R+PL I+ aelLl++ +++++ +
CP000112_3 261 SMGRMVASIAHEIRNPLGIISSSAELLLRRT-------GDADPLT-- 298

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++l+ i +ea+rl + +nd+Ld++r + +
CP000112_3 299 ----------GRILQAIFDEAKRLGQTVNDFLDYARPRRP 328

CP000112_1680: domain 1 of 2, from 349 to 415: score 62.4, E = 2.2e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++a+++HE+R+PL+a+rg+a+ +++ ++ +e+
CP000112_1 349 AVGTLAAGVAHEIRNPLSALRGFAQYFAKKF-------KDRHPEE-- 386

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y +t+ rea+rl+r i dlL l+r +
CP000112_1 387 -----------VYAQTMVREADRLNRVITDLLYLARPRRV 415

CP000112_0878: domain 1 of 1, from 614 to 679: score 60.8, E = 6.3e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++a+l+HE+++PL +I+ yaelL+ + s++q+
CP000112_0 614 TVGKLTAGLAHEINNPLGVILCYAELLRQ----------NISDPQQ- 649

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l++i r +++ +r ++dlL ++r a
CP000112_0 650 ----------GADLDVIVRHTRQAQRVLRDLLNFARPKAA 679

CP000112_3527: domain 1 of 1, from 169 to 244: score 58.6, E = 2.6e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ ++a+++HE+++PLta+ g+ae +++ rl
CP000112_3 169 TMGVLAAGVAHEINNPLTAVTGFAEGIRR----------------RL 199

peLR.l....edpeyreyletilreaerllrLindlLdlsrieag<-*
p LR+l +++ ++ey++til+e r++++++ lL++sr +
CP000112_3 200 PKLRgLvddqLFTDFQEYTDTILKECLRCQDIVQTLLTFSRPSSA 244

CP000112_0505: domain 1 of 1, from 275 to 341: score 54.6, E = 3.6e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +e++ +++HE+R+PL aI g+a +Ll+ ++ l++
CP000112_0 275 AIGELATYIAHEIRNPLFAIGGFANALLR--------SPSLDDNA-- 311

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re ++il+e++rl+ +++ + +++ +
CP000112_0 312 ----------REKARIILEESRRLDTILRSTMNFAKPSDP 341

CP000112_0602: domain 1 of 1, from 443 to 509: score 52.8, E = 1.2e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++ +++HE++TPL I+gya+lL+e + q+
CP000112_0 443 SVGSLAGGVAHEINTPLGIILGYAQLLQE---------DVPEGSQT- 479

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e l++i+r+a+ +++ + dlL +sr +
CP000112_0 480 ----------HEDLKIIERQAKFCRKVVADLLGFSRHSQS 509

CP000112_2820: domain 1 of 1, from 314 to 382: score 52.6, E = 1.3e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++e++a+++HE+++P+++I+ ya+lLl+ +a++ ++ +e
CP000112_2 314 SLGELAAGVAHEINNPVNGIINYAQLLLD-----AAESRKAQAEA-- 353

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++i++e+ r+ ++ +lL ++r + +
CP000112_2 354 -----------GIARKIIKEGSRIADIAHNLLFFARDRRQ 382

CP000112_0110: domain 1 of 1, from 366 to 432: score 52.3, E = 1.7e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++a+++HE+R+PL++I+gya +++ + ++e+
CP000112_0 366 AIGSLAAGVAHEIRNPLSSIKGYATYFGTRF--------AEGSED-- 402

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++ +++ +e++rl+r i+dl l+r
CP000112_0 403 ----------RDAARIMVQEVDRLNRVISDLIGLARPSDL 432

CP000112_1286: domain 1 of 1, from 452 to 517: score 50.7, E = 4.5e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +la +sH+LRTPLta++ ++e L + l++ +
CP000112_1 452 TAGALLARVSHDLRTPLTAMLSTIEELTA----------SLPAHTG- 487

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ l ++++++ l+ +indlLd +r+ g
CP000112_1 488 ----------RKQLALLQSAGRNLQLQINDLLDAARAAKG 517

CP000112_2993: domain 1 of 1, from 515 to 584: score 49.9, E = 7.7e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +e ++ ++HE+++PLt I++ a+ L++ + +++
CP000112_2 515 AWREVARRIAHEIKNPLTPIKLSAQRLQR----------KFGPDI-- 549

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
edp + + +e i r++e+l+++++++ ++++ +
CP000112_2 550 -----EDPIFPQCTELIVRQVEQLQQMVQEFSAFAKLPEV 584

CP000112_2366: domain 1 of 1, from 427 to 493: score 47.2, E = 4.5e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ +++H++++ L +++gy+e+ +e te s+ qr+
CP000112_2 427 AIGTLAGGIAHDFNNILGVMMGYTEMSMDET-------TEGSAMQRR 466

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l+ +l++++r ++Li ++L++sr e++
CP000112_2 467 -------------LDAVLSAGRRARDLIHQILTFSRHEEP 493

CP000112_0696: domain 1 of 1, from 330 to 404: score 46.5, E = 7.1e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++e++a+++HE+++PL+ Ir + +++ + d+ ++e +
CP000112_0 330 ALGELAAGVAHEINNPLAIIREESGWIED-----VLDDGFDNPEAL- 370

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+r+ + i ++ r++++ lL ++r +g
CP000112_0 371 ------EGEIRRSVTQINTQTLRCRDITHKLLSFARRSTG 404

CP000112_3199: domain 1 of 1, from 200 to 266: score 42.6, E = 9.4e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ ++ +++H+ R+P t+I g a +L + ++ +e+ +
CP000112_3 200 ALRLLAQAVAHQVRNPATVIGGVAGMLIR---------QHSGEPAL- 236

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++l++i++e+ rl++++ ++ ++ i ag
CP000112_3 237 ----------GRMLDVIREETLRLEAMVAEVSSFAAISAG 266

CP000112_0239: domain 1 of 1, from 302 to 392: score 42.2, E = 1.2e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldk.....v.lagdtel
+++ ++a+++HEL++PL a++ +++ +++ld + +v++a++t l
CP000112_0 302 SLGSMAAGMAHELNNPLGAVLQGVDTVRRRLDGalpanVrAAHETGL 348

seeqrlpeLR.ledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + +R e + + +l+ i+++++r +++d+Ld+sr +
CP000112_0 349 TLAAL---GRyMEQRRILYFLDGIEHAGRRAAVIVRDMLDFSRQSGE 392

CP000112_3710: domain 1 of 1, from 586 to 657: score 40.7, E = 3.2e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e++ +++HEL++PLt+I+++++ + + +++e+ ++
CP000112_3 586 TLGEMATGVAHELNQPLTVIKTASSFIMR--------KIHRGEPVAP 624

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ L + + + i++ ++r + +in ++d+ r
CP000112_3 625 DVL-------ETMAREIDSHVDRASGIINHMRDFGRQSDI 657

CP000112_0558: domain 1 of 1, from 511 to 601: score 38.0, E = 1.8e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldk....v.lagdtels
+ + ++a+++HE+++PL +I+ a+ + + + +++ ++ + ++
CP000112_0 511 SVGGLAAGMAHEINNPLGGILQGAQNIVR---RisteIkANHAAADE 554

eeqrlpeLR..ledpeyreyletilreaerllrLindlLdlsrieag<-*
l++ R e +++ ++l+ i+++++r ++++++L++sr +
CP000112_0 555 VGCDLTAIRayMEKRGITRFLDGIQESGNRAAKIVSNMLEFSRRSES 601

CP000112_3226: domain 2 of 2, from 785 to 851: score 37.8, E = 2.2e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ ++sH++++ Lt+I+ +el+l ++ e+ + +
CP000112_3 785 AIGTLAGGISHDFNNILTSIINSVELALSDV--------EAASIT-- 821

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l ++l++a+r ++L+ ++L++sr +
CP000112_3 822 ----------FNDLMRALKAAQRGSHLVKQILTFSRPSVE 851

CP000112_0711: domain 1 of 1, from 437 to 515: score 36.5, E = 4.8e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldk...v.lagdtelse
+++e+ a+++HEL++PL+aIr+ ++ L + ++ + +++ g s+
CP000112_0 437 SLGEMSAGVAHELNQPLNAIRMGSDYLAM-VFSslpQnNEGHICISA 482

eqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ re le i +++r ++in l+ +sr
CP000112_0 483 GHA-----------REVLEEIGAQVDRATEIINTLRSFSRKADF 515

CP000112_1261: domain 1 of 1, from 268 to 334: score 34.3, E = 2.1e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + f+ +++H++++ L aI+ +el+le dt+ +++
CP000112_1 268 AIGIFAGGIAHDFNNILGAISSCSELALE--------DTPEDSPV-- 304

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re l +l++a+r +L+ ++ ++s+ +
CP000112_1 305 ----------REDLYHVLKAARRGKNLVKRIKTFSQRTEL 334

CP000112_1071: domain 1 of 1, from 523 to 613: score 34.2, E = 2.1e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++HE+++PL ++ ++ ++++ld + l + r
CP000112_1 523 SVGGLAAGMAHEINNPLGIVLQSVQNMQRRLD------PSLEANARE 563

peLR...l.......edpeyreyletilreaerllrLindlLdlsrieag
++ + +l++ ++ e + + + le i++++ r ++++++Ld++r
CP000112_1 564 AAACgvnLenvqtymERRSIMRSLEHIREAGLRAAEIVRNMLDFTRRNDA 613

<-*

CP000112_1 - -

CP000112_0758: domain 1 of 1, from 536 to 626: score 33.8, E = 2.8e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++HE+++PL +I+ a+ + ++ld +++ + ++
CP000112_0 536 SVGGLAAGMAHEINNPLGGIMQGAQNIIRRLD------PHREANRAA 576

peLR...l.......edpeyreyletilreaerllrLindlLdlsrieag
+ + +l+ + e +++ +++ i+++a+r r+ +++L++sr ag
CP000112_0 577 AQACgcpLeairaylEQRGILRFIGGIEDSARRAARITSNMLEFSRPCAG 626

<-*

CP000112_0 - -

CP000112_2943: domain 1 of 1, from 445 to 535: score 31.4, E = 1.3e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldk.....v.lagdtel
+++ ++++++HE+++PL aI+ ++ + ++ld + + ++a d+
CP000112_2 445 SLGGLASGMAHEINNPLGAILQGVQNISRRLDSrlaanIqAAADSGI 491

seeqrlpeLR...ledpeyreyletilreaerllrLindlLdlsrieag<
s e + ++ R+++ r++l+++++++e+ +++ +L +s+ +++
CP000112_2 492 STEGLEDYIRrrnI-----RKLLHSVRSAGEQAAGIVRSMLSFSQTGTP 535

-*

CP000112_2 - -

CP000112_3031: domain 1 of 1, from 517 to 607: score 31.1, E = 1.7e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldk........v.lagd
+ ++a+++HE+++PL aI +a+ +l+ + +++ + ++++ag+
CP000112_3 517 SVAGLAAGMAHEINNPLGAIAQAAQNCLR---RmgtglpanLhTAGE 560

telseeqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<
l+ ++++L +++ + e i+++ r r+++++L +sr e
CP000112_3 561 LGLDLYAMQTYL--DRRGIYAFMEDIRHSCSRAARIVSNMLAFSRTEKS 607

-*

CP000112_3 - -

CP000112_2944: domain 1 of 1, from 389 to 460: score 29.1, E = 5.9e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ ++ +++HE+++PL+a+++ya+ L++ l + + ++ +
CP000112_2 389 AMGTLAGGIAHEINQPLNALQLYASGLEM----MLEKHGSIEPDVL- 430

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l+ ilrea ++++i ++ e+
CP000112_2 431 ----------YKRLSWILREAGKIREIIAHMRAVVMQEET 460

CP000112_0320: domain 1 of 1, from 348 to 420: score 27.1, E = 2.3e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++a+++HE+++PL+ I a l+ + e + ++++
CP000112_0 348 SIGRLAAGVAHEINNPLAIINEKAGLMND--------LMEHGNDEII 386

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + e++ ++l+++ r++ + +lL ++r +
CP000112_0 387 RAK------FPELVASVLQSVSRCRTITHRLLGFARRMEV 420


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-15 10 0|=
-14 61 0|======
-13 119 2|*=========
-12 261 86|=======*==============
-11 395 447|================================= *
-10 610 830|=================================================== *
-9 670 857|======================================================== *
-8 566 641|================================================ *
-7 401 404|=================================*
-6 255 232|===================*==
-5 176 127|==========*====
-4 96 68|=====*==
-3 44 36|==*=
-2 30 18|=*=
-1 15 9|*=
0 10 5|*
1 6 2|*
2 1 1|*
> 3 49 -|=====


% Statistical details of theoretical EVD fit:
mu = -8.9758
lambda = 0.6525
chi-sq statistic = 515.1631
P(chi-square) = 0

Total sequences searched: 3775

Whole sequence top hits:
tophits_s report:
Total hits: 38
Satisfying E cutoff: 38
Total memory: 22K

Domain top hits:
tophits_s report:
Total hits: 37
Satisfying E cutoff: 37
Total memory: 36K


Acknowledgements:

This research is funded by:

Developed by: