hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000112.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000112_0746 CDS_773612-774775 58.9 4.2e-17 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000112_0746 1/1 186 254 .. 1 70 [] 58.9 4.2e-17
Alignments of top-scoring domains:
CP000112_0746: domain 1 of 1, from 186 to 254: score 58.9, E = 4.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI RELHDs +Q+Ls+ik +le+ r +l+ ++ + e++
CP000112_0 186 ERKRIGRELHDSMAQTLSGIKFMLEGERSRLE-QSGTGWPTERISKT 231
relarealaevRrllgdLRpaal<-*
e +++a+ e+Rr++ dLRp++l
CP000112_0 232 IEYVQHAIVETRRIVMDLRPTVL 254
Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-15 3 0|=
-14 61 0|======
-13 126 0|============
-12 152 42|===*==========
-11 212 345|==================== *
-10 468 802|=========================================== *
-9 647 911|==========================================================*
-8 530 702|================================================= *
-7 463 441|========================================*==
-6 374 250|======================*===========
-5 301 134|============*===============
-4 140 69|======*======
-3 116 36|===*=======
-2 68 18|=*=====
-1 42 9|*===
0 26 4|*==
1 10 2|*
2 12 1|*=
3 13 0|==
4 3 0|=
5 4 0|=
6 2 0|=
> 7 2 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1362.3364
P(chi-square) = 0
Total sequences searched: 3775
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K