Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

1 accessions found for Myxococcus xanthus DK 1622  

Data for CP000113  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_1.hmm [HisKA]
Sequence database: CP000113.Gprot.fsa
per-sequence score cutoff: >= 26.8 [TC1]
per-domain score cutoff: >= 26.8 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA
Accession: PF00512.12
Description: His Kinase A (phosphoacceptor) domain
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000113_2539 CDS_3032327-3035239 108.1 4.8e-30 2
CP000113_2251 CDS_2692970-2695804 97.4 5.2e-27 1
CP000113_4654 CDS_5976871-5978235 96.1 1.2e-26 1
CP000113_1519 CDS_1825873-1823753 91.8 2e-25 1
CP000113_0694 CDS_811933-817836 90.6 4.6e-25 1
CP000113_6533 CDS_8244598-8243090 87.7 2.9e-24 1
CP000113_7185 CDS_8990122-8987594 86.9 5e-24 1
CP000113_2716 CDS_3242210-3238977 85.7 1.1e-23 1
CP000113_6566 CDS_8286000-8278564 85.6 1.2e-23 1
CP000113_4330 CDS_5506823-5503494 84.5 2.4e-23 1
CP000113_0713 CDS_836871-833926 82.2 1.1e-22 1
CP000113_5902 CDS_7494382-7492925 81.7 1.5e-22 1
CP000113_3203 CDS_3846148-3844556 80.0 4.5e-22 1
CP000113_6565 CDS_8278474-8276459 79.4 6.6e-22 1
CP000113_4054 CDS_5114746-5116326 78.6 1.1e-21 1
CP000113_0165 CDS_203476-205323 78.0 1.7e-21 1
CP000113_0193 CDS_243834-241318 76.5 4.4e-21 1
CP000113_0225 CDS_279280-277754 75.5 8.6e-21 1
CP000113_0968 CDS_1149185-1150645 72.0 8.2e-20 1
CP000113_0324 CDS_394530-392434 69.2 5.1e-19 1
CP000113_6782 CDS_8507271-8509037 69.1 5.6e-19 1
CP000113_2710 CDS_3233719-3231890 67.9 1.2e-18 1
CP000113_6886 CDS_8633956-8636175 67.7 1.3e-18 1
CP000113_1321 CDS_1585259-1583730 67.7 1.4e-18 1
CP000113_6823 CDS_8556601-8554280 66.8 2.5e-18 1
CP000113_7007 CDS_8764662-8763139 66.6 2.8e-18 1
CP000113_5636 CDS_7162657-7161080 66.2 3.6e-18 1
CP000113_6800 CDS_8532527-8531292 66.2 3.6e-18 1
CP000113_5966 CDS_7563441-7565138 65.3 6.5e-18 1
CP000113_7263 CDS_9069342-9067687 65.0 8.2e-18 1
CP000113_0192 CDS_239406-241313 64.4 1.2e-17 1
CP000113_5179 CDS_6616052-6617452 64.2 1.3e-17 1
CP000113_6821 CDS_8553864-8552605 63.9 1.7e-17 1
CP000113_6829 CDS_8566072-8563625 63.6 2e-17 1
CP000113_0989 CDS_1182811-1184352 63.1 2.7e-17 1
CP000113_6252 CDS_7901234-7899411 62.9 3.2e-17 1
CP000113_5340 CDS_6825556-6823820 62.8 3.3e-17 1
CP000113_6795 CDS_8527242-8525272 62.8 3.4e-17 1
CP000113_6421 CDS_8111014-8113608 62.7 3.6e-17 1
CP000113_0913 CDS_1076044-1074566 62.3 4.8e-17 1
CP000113_5629 CDS_7154991-7153870 61.5 7.7e-17 1
CP000113_0702 CDS_821386-823965 61.5 8e-17 1
CP000113_3255 CDS_3887590-3885347 61.3 9.2e-17 1
CP000113_0173 CDS_213061-214989 59.6 2.8e-16 1
CP000113_6154 CDS_7796814-7794916 58.9 4.4e-16 1
CP000113_3015 CDS_3628476-3627304 58.6 5.1e-16 1
CP000113_1222 CDS_1463335-1461842 58.6 5.1e-16 1
CP000113_4133 CDS_5205316-5204210 58.5 5.4e-16 1
CP000113_4329 CDS_5503497-5501650 57.9 8.1e-16 1
CP000113_3330 CDS_3974396-3972921 57.4 1.1e-15 1
CP000113_6830 CDS_8566252-8568552 57.0 1.5e-15 1
CP000113_0688 CDS_807516-805921 56.7 1.8e-15 1
CP000113_5229 CDS_6680604-6679021 55.4 4.2e-15 1
CP000113_0298 CDS_360394-358250 55.1 5.1e-15 1
CP000113_0554 CDS_657295-659562 54.2 9.4e-15 1
CP000113_5051 CDS_6476868-6478604 54.1 9.7e-15 1
CP000113_6770 CDS_8495265-8496989 53.8 1.2e-14 1
CP000113_1051 CDS_1254015-1256507 53.0 2e-14 1
CP000113_4086 CDS_5153190-5151901 52.4 3e-14 1
CP000113_0384 CDS_462051-459424 52.3 3.3e-14 1
CP000113_5839 CDS_7416816-7415482 51.8 4.5e-14 1
CP000113_0191 CDS_239401-236498 51.6 5e-14 1
CP000113_7258 CDS_9060497-9062002 51.3 6.3e-14 1
CP000113_2694 CDS_3217854-3219419 51.0 7.7e-14 1
CP000113_4858 CDS_6240422-6238815 50.7 9.1e-14 1
CP000113_0335 CDS_409044-406435 50.5 1e-13 1
CP000113_1103 CDS_1315440-1313908 50.4 1.1e-13 1
CP000113_0443 CDS_522573-523982 50.1 1.3e-13 1
CP000113_5864 CDS_7444098-7445744 50.0 1.4e-13 1
CP000113_0625 CDS_743962-742253 49.9 1.5e-13 1
CP000113_0057 CDS_68306-70582 49.8 1.6e-13 1
CP000113_7189 CDS_8993282-8994913 49.6 1.9e-13 1
CP000113_7219 CDS_9024124-9021125 49.3 2.2e-13 1
CP000113_3868 CDS_4840166-4838064 49.0 2.7e-13 1
CP000113_4520 CDS_5823072-5820562 48.2 4.5e-13 1
CP000113_6950 CDS_8695976-8697577 47.7 6.2e-13 1
CP000113_1645 CDS_1988195-1987029 46.5 1.4e-12 1
CP000113_6678 CDS_8400636-8399242 45.8 2.2e-12 1
CP000113_0240 CDS_292680-294749 45.4 2.8e-12 1
CP000113_3362 CDS_4018389-4019747 45.0 3.7e-12 1
CP000113_2302 CDS_2754262-2756922 44.9 4e-12 1
CP000113_2959 CDS_3562517-3564061 44.9 4e-12 1
CP000113_0328 CDS_398613-396925 44.5 5.3e-12 1
CP000113_0594 CDS_707603-709774 43.7 8.6e-12 1
CP000113_4140 CDS_5211198-5213321 43.1 1.3e-11 1
CP000113_6696 CDS_8419781-8417886 42.9 1.5e-11 1
CP000113_3708 CDS_4581856-4580501 42.7 1.7e-11 1
CP000113_4903 CDS_6294467-6296014 42.4 2.1e-11 1
CP000113_0716 CDS_842030-840186 41.7 3.3e-11 1
CP000113_4350 CDS_5527707-5529260 41.2 4.4e-11 1
CP000113_1163 CDS_1387934-1386660 40.9 5.3e-11 1
CP000113_6697 CDS_8421810-8419792 40.8 5.8e-11 1
CP000113_2618 CDS_3136584-3135712 40.6 6.4e-11 1
CP000113_0903 CDS_1058355-1057351 40.5 6.9e-11 1
CP000113_0906 CDS_1061417-1063750 40.2 8.8e-11 1
CP000113_4991 CDS_6399790-6400815 40.0 9.8e-11 1
CP000113_4151 CDS_5226631-5224523 39.7 1.2e-10 1
CP000113_5845 CDS_7421234-7422625 37.3 5.6e-10 1
CP000113_4461 CDS_5716346-5718484 37.0 7e-10 1
CP000113_5077 CDS_6505914-6504442 36.9 7.5e-10 1
CP000113_2320 CDS_2776797-2774506 36.1 1.2e-09 1
CP000113_6784 CDS_8511127-8512632 35.6 1.7e-09 2
CP000113_2884 CDS_3470145-3469120 34.2 4.4e-09 1
CP000113_5703 CDS_7259098-7262070 33.8 5.4e-09 1
CP000113_0308 CDS_369075-371150 33.2 8e-09 1
CP000113_6068 CDS_7690679-7691962 32.9 9.7e-09 1
CP000113_5556 CDS_7071138-7072604 31.6 2.3e-08 1
CP000113_4135 CDS_5207191-5206001 31.3 2.9e-08 1
CP000113_3773 CDS_4658792-4661380 31.0 3.4e-08 1
CP000113_7033 CDS_8797341-8793202 30.6 4.5e-08 1
CP000113_6807 CDS_8537161-8538471 29.4 9.8e-08 1
CP000113_6686 CDS_8409762-8407234 29.0 1.2e-07 1
CP000113_1140 CDS_1360383-1361813 27.8 2.7e-07 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000113_2251 1/1 269 334 .. 1 87 [] 97.4 5.2e-27
CP000113_4654 1/1 223 290 .. 1 87 [] 96.1 1.2e-26
CP000113_1519 1/1 476 544 .. 1 87 [] 91.8 2e-25
CP000113_0694 1/1 1269 1337 .. 1 87 [] 90.6 4.6e-25
CP000113_6533 1/1 245 313 .. 1 87 [] 87.7 2.9e-24
CP000113_7185 1/1 352 420 .. 1 87 [] 86.9 5e-24
CP000113_2716 1/1 696 762 .. 1 87 [] 85.7 1.1e-23
CP000113_6566 1/1 1773 1841 .. 1 87 [] 85.6 1.2e-23
CP000113_4330 1/1 423 491 .. 1 87 [] 84.5 2.4e-23
CP000113_0713 1/1 350 418 .. 1 87 [] 82.2 1.1e-22
CP000113_5902 1/1 264 332 .. 1 87 [] 81.7 1.5e-22
CP000113_2539 1/2 319 386 .. 1 87 [] 80.9 2.5e-22
CP000113_3203 1/1 162 230 .. 1 87 [] 80.0 4.5e-22
CP000113_6565 1/1 431 499 .. 1 87 [] 79.4 6.6e-22
CP000113_4054 1/1 304 372 .. 1 87 [] 78.6 1.1e-21
CP000113_0165 1/1 385 453 .. 1 87 [] 78.0 1.7e-21
CP000113_0193 1/1 599 671 .. 1 87 [] 76.5 4.4e-21
CP000113_0225 1/1 147 213 .. 1 87 [] 75.5 8.6e-21
CP000113_0968 1/1 264 330 .. 1 87 [] 72.0 8.2e-20
CP000113_0324 1/1 457 523 .. 1 87 [] 69.2 5.1e-19
CP000113_6782 1/1 346 415 .. 1 87 [] 69.1 5.6e-19
CP000113_2710 1/1 386 452 .. 1 87 [] 67.9 1.2e-18
CP000113_6886 1/1 506 572 .. 1 87 [] 67.7 1.3e-18
CP000113_1321 1/1 282 349 .. 1 87 [] 67.7 1.4e-18
CP000113_6823 1/1 550 616 .. 1 87 [] 66.8 2.5e-18
CP000113_7007 1/1 264 332 .. 1 87 [] 66.6 2.8e-18
CP000113_5636 1/1 315 380 .. 1 87 [] 66.2 3.6e-18
CP000113_6800 1/1 175 246 .. 1 87 [] 66.2 3.6e-18
CP000113_5966 1/1 340 413 .. 1 87 [] 65.3 6.5e-18
CP000113_7263 1/1 324 392 .. 1 87 [] 65.0 8.2e-18
CP000113_0192 1/1 389 464 .. 1 87 [] 64.4 1.2e-17
CP000113_5179 1/1 245 307 .. 1 87 [] 64.2 1.3e-17
CP000113_6821 1/1 178 244 .. 1 87 [] 63.9 1.7e-17
CP000113_6829 1/1 588 654 .. 1 87 [] 63.6 2e-17
CP000113_0989 1/1 276 342 .. 1 87 [] 63.1 2.7e-17
CP000113_6252 1/1 387 453 .. 1 87 [] 62.9 3.2e-17
CP000113_5340 1/1 349 423 .. 1 87 [] 62.8 3.3e-17
CP000113_6795 1/1 425 496 .. 1 87 [] 62.8 3.4e-17
CP000113_6421 1/1 619 692 .. 1 87 [] 62.7 3.6e-17
CP000113_0913 1/1 258 324 .. 1 87 [] 62.3 4.8e-17
CP000113_5629 1/1 161 226 .. 1 87 [] 61.5 7.7e-17
CP000113_0702 1/1 630 698 .. 1 87 [] 61.5 8e-17
CP000113_3255 1/1 471 536 .. 1 87 [] 61.3 9.2e-17
CP000113_0173 1/1 418 485 .. 1 87 [] 59.6 2.8e-16
CP000113_6154 1/1 271 338 .. 1 87 [] 58.9 4.4e-16
CP000113_3015 1/1 162 235 .. 1 87 [] 58.6 5.1e-16
CP000113_1222 1/1 272 340 .. 1 87 [] 58.6 5.1e-16
CP000113_4133 1/1 148 219 .. 1 87 [] 58.5 5.4e-16
CP000113_4329 1/1 397 463 .. 1 87 [] 57.9 8.1e-16
CP000113_3330 1/1 281 345 .. 1 87 [] 57.4 1.1e-15
CP000113_6830 1/1 545 607 .. 1 87 [] 57.0 1.5e-15
CP000113_0688 1/1 299 366 .. 1 87 [] 56.7 1.8e-15
CP000113_5229 1/1 302 368 .. 1 87 [] 55.4 4.2e-15
CP000113_0298 1/1 478 550 .. 1 87 [] 55.1 5.1e-15
CP000113_0554 1/1 523 589 .. 1 87 [] 54.2 9.4e-15
CP000113_5051 1/1 361 432 .. 1 87 [] 54.1 9.7e-15
CP000113_6770 1/1 344 415 .. 1 87 [] 53.8 1.2e-14
CP000113_1051 1/1 605 671 .. 1 87 [] 53.0 2e-14
CP000113_4086 1/1 220 286 .. 1 87 [] 52.4 3e-14
CP000113_0384 1/1 651 717 .. 1 87 [] 52.3 3.3e-14
CP000113_5839 1/1 218 287 .. 1 87 [] 51.8 4.5e-14
CP000113_0191 1/1 582 668 .. 1 87 [] 51.6 5e-14
CP000113_7258 1/1 268 334 .. 1 87 [] 51.3 6.3e-14
CP000113_2694 1/1 155 228 .. 1 87 [] 51.0 7.7e-14
CP000113_4858 1/1 307 369 .. 1 87 [] 50.7 9.1e-14
CP000113_0335 1/1 619 687 .. 1 87 [] 50.5 1e-13
CP000113_1103 1/1 283 352 .. 1 87 [] 50.4 1.1e-13
CP000113_0443 1/1 243 316 .. 1 87 [] 50.1 1.3e-13
CP000113_5864 1/1 328 394 .. 1 87 [] 50.0 1.4e-13
CP000113_0625 1/1 330 397 .. 1 87 [] 49.9 1.5e-13
CP000113_0057 1/1 521 588 .. 1 87 [] 49.8 1.6e-13
CP000113_7189 1/1 306 378 .. 1 87 [] 49.6 1.9e-13
CP000113_7219 1/1 776 845 .. 1 87 [] 49.3 2.2e-13
CP000113_3868 1/1 457 532 .. 1 87 [] 49.0 2.7e-13
CP000113_4520 1/1 326 391 .. 1 87 [] 48.2 4.5e-13
CP000113_6950 1/1 309 378 .. 1 87 [] 47.7 6.2e-13
CP000113_1645 1/1 192 255 .. 1 87 [] 46.5 1.4e-12
CP000113_6678 1/1 220 286 .. 1 87 [] 45.8 2.2e-12
CP000113_0240 1/1 461 533 .. 1 87 [] 45.4 2.8e-12
CP000113_3362 1/1 237 303 .. 1 87 [] 45.0 3.7e-12
CP000113_2302 1/1 659 732 .. 1 87 [] 44.9 4e-12
CP000113_2959 1/1 287 359 .. 1 87 [] 44.9 4e-12
CP000113_0328 1/1 335 407 .. 1 87 [] 44.5 5.3e-12
CP000113_0594 1/1 484 560 .. 1 87 [] 43.7 8.6e-12
CP000113_4140 1/1 476 542 .. 1 87 [] 43.1 1.3e-11
CP000113_6696 1/1 411 481 .. 1 87 [] 42.9 1.5e-11
CP000113_3708 1/1 222 287 .. 1 87 [] 42.7 1.7e-11
CP000113_4903 1/1 294 368 .. 1 87 [] 42.4 2.1e-11
CP000113_0716 1/1 380 448 .. 1 87 [] 41.7 3.3e-11
CP000113_4350 1/1 47 109 .. 1 87 [] 41.2 4.4e-11
CP000113_1163 1/1 203 273 .. 1 87 [] 40.9 5.3e-11
CP000113_6697 1/1 587 653 .. 1 87 [] 40.8 5.8e-11
CP000113_2618 1/1 100 158 .. 9 87 .] 40.6 6.4e-11
CP000113_0903 1/1 91 165 .. 1 87 [] 40.5 6.9e-11
CP000113_0906 1/1 406 481 .. 1 87 [] 40.2 8.8e-11
CP000113_4991 1/1 128 194 .. 1 87 [] 40.0 9.8e-11
CP000113_4151 1/1 473 539 .. 1 87 [] 39.7 1.2e-10
CP000113_5845 1/1 234 297 .. 1 87 [] 37.3 5.6e-10
CP000113_4461 1/1 480 546 .. 1 87 [] 37.0 7e-10
CP000113_5077 1/1 266 324 .. 1 87 [] 36.9 7.5e-10
CP000113_2320 1/1 388 470 .. 1 87 [] 36.1 1.2e-09
CP000113_6784 1/2 265 326 .. 1 83 [. 35.4 2e-09
CP000113_2884 1/1 106 173 .. 1 87 [] 34.2 4.4e-09
CP000113_5703 1/1 756 822 .. 1 87 [] 33.8 5.4e-09
CP000113_0308 1/1 319 399 .. 1 87 [] 33.2 8e-09
CP000113_6068 1/1 205 270 .. 1 87 [] 32.9 9.7e-09
CP000113_5556 1/1 268 334 .. 1 87 [] 31.6 2.3e-08
CP000113_4135 1/1 170 237 .. 1 87 [] 31.3 2.9e-08
CP000113_3773 1/1 348 414 .. 1 87 [] 31.0 3.4e-08
CP000113_7033 1/1 843 923 .. 1 87 [] 30.6 4.5e-08
CP000113_6807 1/1 216 281 .. 1 87 [] 29.4 9.8e-08
CP000113_6686 1/1 451 522 .. 1 87 [] 29.0 1.2e-07
CP000113_1140 1/1 232 299 .. 1 87 [] 27.8 2.7e-07
CP000113_2539 2/2 731 801 .. 1 87 [] 27.3 4e-07

Alignments of top-scoring domains:
CP000113_2251: domain 1 of 1, from 269 to 334: score 97.4, E = 5.2e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks fla++sHE+RTP++aI+g++ lLl+ +l+eeq
CP000113_2 269 AKSLFLATMSHEIRTPMNAIIGMTGLLLD---------RALTEEQ-- 304

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+++ ti++++e ll L+nd+Ld+s+ieag
CP000113_2 305 ----------RDFVATIRQSSEALLTLLNDVLDFSKIEAG 334

CP000113_4654: domain 1 of 1, from 223 to 290: score 96.1, E = 1.2e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +f+an+sHELRTP+taIrgyae+L+ ++l+++ ++
CP000113_4 223 VRKDFVANVSHELRTPITAIRGYAETLQG---------GALNDPVMA 260

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++e+i+r++erl++L++dlL+lsr+e+
CP000113_4 261 ----------PKMVEIIHRQSERLSELVEDLLELSRLESR 290

CP000113_1519: domain 1 of 1, from 476 to 544: score 91.8, E = 2e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+flan+sHE+RTPL+aI+gy+ +Ll ++ ++el++ q
CP000113_1 476 AKSQFLANMSHEFRTPLNAILGYTNMLLQGV------SGELNPAQ-- 514

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l +i++ +++ll+ in++Ld++rieag
CP000113_1 515 ----------KRNLTRIDSNGRHLLEVINEILDITRIEAG 544

CP000113_0694: domain 1 of 1, from 1269 to 1337: score 90.6, E = 4.6e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
kseflan+sHELRTPL++++ ++++L +++d ++l++ q
CP000113_0 1269 YKSEFLANMSHELRTPLNSLLILSQTLSDNVD------GNLTSRQ-- 1307

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+ +ti+ ++ ll+Lind+Ldls+ie+g
CP000113_0 1308 ----------VEFAKTIHASGADLLELINDILDLSKIESG 1337

CP000113_6533: domain 1 of 1, from 245 to 313: score 87.7, E = 2.9e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks fl ++sHELRTPL++I+gy+e+L e+l ++l++eq
CP000113_6 245 LKSTFLGTVSHELRTPLASIIGYSEMLAEGLA------GALNPEQ-- 283

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y++ti + +e+ll+Li+ +Ldls+ieag
CP000113_6 284 ----------LLYVRTIVEKGESLLNLISSILDLSQIEAG 313

CP000113_7185: domain 1 of 1, from 352 to 420: score 86.9, E = 5e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+ef++++sHELRTPLt+Irg + lL+ ++ ++ +++
CP000113_7 352 MKNEFISTVSHELRTPLTSIRGSLGLLEG------GIVGDIPPQA-- 390

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++++++ +erl rLind+Ldl+++eag
CP000113_7 391 ----------LDMVRIARTNTERLIRLINDILDLEKMEAG 420

CP000113_2716: domain 1 of 1, from 696 to 762: score 85.7, E = 1.1e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+efla++sHELRTPLta++g +++L++ ++l++e+r
CP000113_2 696 LKDEFLATVSHELRTPLTAVLGWVQMLRT---------GTLPPEKR- 732

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l t++r a+ +L++dlLd sri +g
CP000113_2 733 ----------ERALATVERNARAQGQLVEDLLDVSRIMTG 762

CP000113_6566: domain 1 of 1, from 1773 to 1841: score 85.6, E = 1.2e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
kseflan+sHELRTPL++++ +a+lL + +d++ls +q
CP000113_6 1773 YKSEFLANMSHELRTPLNSLLILAKLLSD------NKDGNLSTKQ-- 1811

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
ey +ti+ ++ ll+Lin++Ldls+ eag
CP000113_6 1812 ----------VEYANTIYASGGDLLSLINEILDLSKVEAG 1841

CP000113_4330: domain 1 of 1, from 423 to 491: score 84.5, E = 2.4e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+ef++++sHELRTPLt+I+g+++l l+++ ++ +e q
CP000113_4 423 RKDEFVSMVSHELRTPLTSISGALDLVLNFMA------GDINERQ-- 461

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+yl+ +++++e l+++++dlLdls+ g
CP000113_4 462 ----------RRYLSLARDSTEKLNAIVDDLLDLSKFAKG 491

CP000113_0713: domain 1 of 1, from 350 to 418: score 82.2, E = 1.1e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
kseflan sHE+RTPL++I+gy++lL + + + l++
CP000113_0 350 LKSEFLANFSHEIRTPLNGIIGYCDLLMR------EEGQRLTAHG-- 388

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ l++++ a+ ll+Lind+Ldls+ie+g
CP000113_0 389 ----------RRDLNVVKTNAKTLLALINDILDLSKIESG 418

CP000113_5902: domain 1 of 1, from 264 to 332: score 81.7, E = 1.5e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ +fla+++H+LRTPL+a+++ a++Ll+ t+ ++e++
CP000113_5 264 RQLQFLAGVAHDLRTPLNALKLSAQMLLR-------AKTAPPPEKV- 302

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ l +i ++++rl+r++ dlLd +rieag
CP000113_5 303 ----------RDSLVRISNQVDRLERMVGDLLDRTRIEAG 332

CP000113_2539: domain 1 of 2, from 319 to 386: score 80.9, E = 2.5e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ksef+ n+sHELRTPLt I++++e+L +e+ + l++e
CP000113_2 319 LKSEFFDNVSHELRTPLTLILLTLEALAKEA-------ESLPPEL-- 356

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ ++r+a+rllrLin+lLdl+++e+g
CP000113_2 357 ----------PPLVTNMERSAQRLLRLINNLLDLAQLESG 386

CP000113_3203: domain 1 of 1, from 162 to 230: score 80.0, E = 4.5e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e+l n+sH+L++PLt+I+ y+ ++ + + ++l++ q
CP000113_3 162 NREELLGNVSHDLKNPLTTIKSYLAMMGR------EKLGPLTDAQ-- 200

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+++++ +r ++r+lr++ndlL +sr+++g
CP000113_3 201 ----------RRAVQICDRNSDRMLRMVNDLLLMSRLQSG 230

CP000113_6565: domain 1 of 1, from 431 to 499: score 79.4, E = 6.6e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+ fla++sHELRTPL+a +g+a+l+l +l +g+te+++
CP000113_6 431 AKDSFLAAASHELRTPLAAAKGHAHLALLKL----GGETEAGP---- 469

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l++i r+++r+ +L++dlLd+sr++ag
CP000113_6 470 ----------GKSLKIINRQIDRMAKLVEDLLDISRLQAG 499

CP000113_4054: domain 1 of 1, from 304 to 372: score 78.6, E = 1.1e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ f+an+sHE++TPL++I+g++elL++ + +++s+eqr
CP000113_4 304 YIRSFAANVSHEFKTPLASIQGAVELLRDSA-------DAMSPEQR- 342

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l ++ +a+rl rL+++lL+l+r+++
CP000113_4 343 ----------ARFLANVDADARRLTRLVQRLLELARADSM 372

CP000113_0165: domain 1 of 1, from 385 to 453: score 78.0, E = 1.7e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++++a+++HE+RTPLt++r++++l e++ ++ +e+q
CP000113_0 385 LKNDLVATVAHEFRTPLTSLRMALHLVTEGV------VGPVTEKQ-- 423

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l +++++erl+ +++dlLdlsri+ag
CP000113_0 424 ----------ADLLFAAREDSERLQGIVDDLLDLSRIQAG 453

CP000113_0193: domain 1 of 1, from 599 to 671: score 76.5, E = 4.4e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++efl+ +sHELRTPLt ++g+a l l +l+k +++ +e +rl
CP000113_0 599 AREEFLSVASHELRTPLTPLKGFAALTLQRLEK----SGDFPERERL 641

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++l+++ r++erl rL++dlLd +ri+ g
CP000113_0 642 ----------LKALRSMARQTERLTRLVDDLLDTARIQGG 671

CP000113_0225: domain 1 of 1, from 147 to 213: score 75.5, E = 8.6e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+efla+l HELR+PL+aI++++ +L++ +++ ++++
CP000113_0 147 RKDEFLAMLGHELRNPLAAIMTAIGILER--------RPTSDDKE-- 183

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ +i+r++++l rL++dlLd sri
CP000113_0 184 ----------ARMRGIIQRQTNHLARLVDDLLDVSRITRD 213

CP000113_0968: domain 1 of 1, from 264 to 330: score 72.0, E = 8.2e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +l H+LR+PL+a+++ a+ L++ + l+e q
CP000113_0 264 FREQFIGMLGHDLRNPLNALSMSAQQLRR--------KGGLDERQ-- 300

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++e+il +aer++r+i++lLd++r + g
CP000113_0 301 ----------GMLTERILTSAERMDRMIRQLLDFARSRLG 330

CP000113_0324: domain 1 of 1, from 457 to 523: score 69.2, E = 5.1e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++ +sH+LR+PL aI+++++++l ++ l+e q
CP000113_0 457 FERQLIGIVSHDLRNPLGAISLAVSMMLQ--------RGLLDERQ-- 493

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ ++i+++a+r r+i+dlLd++r+++g
CP000113_0 494 ----------ARQAQRIRSSADRATRMIRDLLDFTRARQG 523

CP000113_6782: domain 1 of 1, from 346 to 415: score 69.1, E = 5.6e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++++la +sH+L++PL ++++ a lLl+++ ++++ +
CP000113_6 346 AREDLLAVVSHDLKNPLGVVQLGAALLLRGA-------GAKPGGES- 384

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ +i++++er++rLi+dlLd r+eag
CP000113_6 385 ---------VAKQATRIQDATERMSRLISDLLDWGRLEAG 415

CP000113_2710: domain 1 of 1, from 386 to 452: score 67.9, E = 1.2e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f+a++sHELRTPL++Ir++ e+L+++l ++ +e
CP000113_2 386 LKSDFVATVSHELRTPLASIRLLGETLERKL--------AQAPEV-- 422

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+y +i ++a+ l L++++L + ri+ g
CP000113_2 423 ----------RDYPARIVQAADGLHFLVENILSFNRIDKG 452

CP000113_6886: domain 1 of 1, from 506 to 572: score 67.7, E = 1.3e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++++a l H+LR+PL+aI + a L + +++l++++
CP000113_6 506 FREQLMAVLGHDLRNPLNAINASAFQLTR--------SEDLTPPE-- 542

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+++++i++++ r+ r+i d+Ld++r + g
CP000113_6 543 ----------RRAVDRIRKATARMGRMITDILDFARTRLG 572

CP000113_1321: domain 1 of 1, from 282 to 349: score 67.7, E = 1.4e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k++f++ +sHELRTPLt+Ir+++e+L g+ + ++++
CP000113_1 282 MKTDFVSLVSHELRTPLTSIRMFIETLAL-------GRLKDPAQT-- 319

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e l + re+erl+ ++++Ld +rie g
CP000113_1 320 ----------QEVLTLLMRETERLSIFVERVLDWARIEGG 349

CP000113_6823: domain 1 of 1, from 550 to 616: score 66.8, E = 2.5e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++ +sH+LR+PL+aI++ a lL++ ++l+e+q
CP000113_6 550 FEQQLVGIVSHDLRNPLAAISMSAGLLEK--------KGALTEPQ-- 586

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++ +i +++er r+i+dlLd+++++ g
CP000113_6 587 ----------KRMVWRIGQATERAARMIRDLLDFTKARLG 616

CP000113_7007: domain 1 of 1, from 264 to 332: score 66.6, E = 2.8e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ fla+++HELR+PL+a+++ + l + +++ l++e +
CP000113_7 264 QQLAFLAGVAHELRNPLSALKLSTALSDR-------SRAQLTPERM- 302

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l+ + r++erl+r++ dlLd +rieag
CP000113_7 303 ----------DRTLSLVGRQVERLDRMVGDLLDATRIEAG 332

CP000113_5636: domain 1 of 1, from 315 to 380: score 66.2, E = 3.6e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ + a l+HELR+PL+++rg a+lL +++++
CP000113_5 315 SLGALSAQLAHELRNPLASMRGSAQLLAQ---------DARDDVA-- 350

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++++++ re++rl rL++++L ++r +
CP000113_5 351 ----------QKLTNILMRESDRLARLVEEFLRFARPPVP 380

CP000113_6800: domain 1 of 1, from 175 to 246: score 66.2, E = 3.6e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++efl+ ++HELRTPLt++r++++lLl+++ +g+ ++ ++
CP000113_6 175 ARDEFLSVAAHELRTPLTSLRLHLQLLLRQV----GGSNQEPPAEL- 216

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++++r++ rl L+n lLd sr+ ag
CP000113_6 217 ----------APRARVLDRQLSRLVGLVNTLLDVSRLAAG 246

CP000113_5966: domain 1 of 1, from 340 to 413: score 65.3, E = 6.5e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
+++fl+++sHELRTPLt++r+ ++lL++ + +++g t s++
CP000113_5 340 TRDDFLSMASHELRTPLTSLRLQLQLLRRLG--AsTPGATLGSDKV- 383

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l+ +r+++rl +L+++lLd sri++g
CP000113_5 384 -----------AGKLDNTERQLRRLGALVDNLLDVSRIQTG 413

CP000113_7263: domain 1 of 1, from 324 to 392: score 65.0, E = 8.2e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+ fl +++HELRTPL a rgya+l+ ++ ++l +
CP000113_7 324 AKDMFLTMAAHELRTPLQAARGYAHLASVKAG------DTLAPGV-- 362

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++l+ i+r+++r+ +L+++lLd ri+ g
CP000113_7 363 ----------DKALHGIHRSVNRMAKLVENLLDVGRIQRG 392

CP000113_0192: domain 1 of 1, from 389 to 464: score 64.4, E = 1.2e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
++efl +sHEL+TPLt + + ++lL++++d +a+ ++ s+e +
CP000113_0 389 LRDEFLGIASHELKTPLTPLHLKVQLLQKQVD-GmAAHNQPVSAERV 434

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e le+++r+++ l +L+++lLd sri ag
CP000113_0 435 -----------SETLEVVQRQVRKLTSLVDNLLDVSRITAG 464

CP000113_5179: domain 1 of 1, from 245 to 307: score 64.2, E = 1.3e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e+la++sHELRTPL+ +r ++elL++ + ++++
CP000113_5 245 DQRELLAAVSHELRTPLARLRVLTELLRD---------GGGNPKT-- 280

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l+ ++re+ l++L+ +lL sr++ g
CP000113_5 281 -------------LDQVDREVVELDALVGELLASSRLDFG 307

CP000113_6821: domain 1 of 1, from 178 to 244: score 63.9, E = 1.7e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ l H+LR+PL+aI + a ++ +l++ q+
CP000113_6 178 FRERFIGILGHDLRNPLNAIALSARAMAQ---------RTLPAAQQ- 214

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ ++i+ +a r+ ++i+d+Ldl+r++
CP000113_6 215 ----------QQCAQRIEASAARMGAMISDILDLTRARLA 244

CP000113_6829: domain 1 of 1, from 588 to 654: score 63.6, E = 2e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++a +sH+LR+PL+aI++ a Ll +++l+e +
CP000113_6 588 FGERLIAIVSHDLRNPLNAIQLSATQLLH--------SEALPERE-- 624

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+++ +i r+++r+ r+i++lLd++r + g
CP000113_6 625 ----------RRLVTRIARSGDRMKRMISELLDFTRGRLG 654

CP000113_0989: domain 1 of 1, from 276 to 342: score 63.1, E = 2.7e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ l H+L +PL+a+r+ + +Ll+ +++l++e
CP000113_0 276 FQERFIGVLGHDLGNPLAAVRLSSAALLA--------RDTLPPEV-- 312

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ + +i+ +aer+ rL+ +lLd++r++
CP000113_0 313 ----------RRVVARIDGSAERMARLVKQLLDFTRARMA 342

CP000113_6252: domain 1 of 1, from 387 to 453: score 62.9, E = 3.2e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f+a++sHELRTPL++Ir++ae+L+ +l +e ++
CP000113_6 387 LKSDFVATVSHELRTPLASIRLLAETLEWRL-------AEGTDAR-- 424

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+y +i rea+ l L+++lL + ri+ g
CP000113_6 425 -----------DYPARIVREADGLGFLVENLLSFNRIDKG 453

CP000113_5340: domain 1 of 1, from 349 to 423: score 62.8, E = 3.3e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
a++ fl+ +sHEL+TPLt++++++++L++++ + a+ +++s+e +
CP000113_5 349 ARDSFLSVASHELNTPLTSLMLNIQALRRDM--EpRASNGPASPEAL 393

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++r++ rl++L+++lLd sri ag
CP000113_5 394 -----------STKVVAVQRQVSRLSSLVRELLDVSRITAG 423

CP000113_6795: domain 1 of 1, from 425 to 496: score 62.8, E = 3.4e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
a+++fl+ ++HELRTPL+a+r+ ++ ++ v ag + +e
CP000113_6 425 ARDDFLSVAAHELRTPLAALRLRVQGAQG----VlRAGLSSGTERL- 466

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l++++r+++rl++L++ lLd s+++ g
CP000113_6 467 -----------ERALDSADRQVQRLSDLVESLLDVSQLQGG 496

CP000113_6421: domain 1 of 1, from 619 to 692: score 62.7, E = 3.6e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
++efl+ +sHEL+TP+t++++ ++ Ll+ + +++ ++s+e++
CP000113_6 619 LRDEFLSVASHELKTPVTSLQLSVQGLLR---RArSGALCTASAETV 662

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +e i+r+a r+ +L+n lLd sri ag
CP000113_6 663 -----------TQSVEGIERQAMRMAKLVNTLLDVSRIHAG 692

CP000113_0913: domain 1 of 1, from 258 to 324: score 62.3, E = 4.8e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++++++HEL TPL++++g a+++ +e+ e++
CP000113_0 258 TVGKLASGVAHELGTPLNVVMGRAKMISS---------GEAEGEEV- 294

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e ++i ++a+++ ++i++lLd++r + +
CP000113_0 295 ----------GECAQIISQQAQHMTAIIRQLLDFARRRKP 324

CP000113_5629: domain 1 of 1, from 161 to 226: score 61.5, E = 7.7e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++a+++HE +PL++I+gy+ l++ + ++e
CP000113_5 161 TVGRLAAGVAHEVGNPLAGILGYVALARV---------KADTPEL-- 196

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++le+i++e++r++r+i+ lLdl r +
CP000113_5 197 ----------KDFLERIDHEVQRIDRIIRGLLDLGRPGVT 226

CP000113_0702: domain 1 of 1, from 630 to 698: score 61.5, E = 8e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++efl+ +sHEL+TPLt++++ l+ + a ++ +++
CP000113_0 630 LRDEFLSVASHELKTPLTSLKLQHGLIDR------AALGDVGDKV-- 668

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r l t+ r+++rl++L++ lLd sri g
CP000113_0 669 ----------RPRLATAVRQVQRLSALVDSLLDVSRISLG 698

CP000113_3255: domain 1 of 1, from 471 to 536: score 61.3, E = 9.2e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++e++a+l+HE+R+PL aI+g+a+ L + e+
CP000113_3 471 ALGEMAAGLAHEIRNPLGAIKGAAQCLDP---------VHYQGED-- 506

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+le+i +e++rl+ + +Ld++r +
CP000113_3 507 ----------AEFLEVIVEEVNRLNGVVTAFLDYARPLKQ 536

CP000113_0173: domain 1 of 1, from 418 to 485: score 59.6, E = 2.8e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++fl+ ++HEL+TPLt +++++++L+ + +e +
CP000113_0 418 VRDDFLSIAAHELKTPLTPLKLHLQMLRQHG-------AEGDGAS-- 455

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ +++ l ++ rl L+ndlLd sri++g
CP000113_0 456 ----------ARHVDKSLMQVSRLTGLVNDLLDTSRIQEG 485

CP000113_6154: domain 1 of 1, from 271 to 338: score 58.9, E = 4.4e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ef++ +sHEL+TPLt +++ + +++++l + + +
CP000113_6 271 VREEFISIASHELKTPLTPLKLGLFTMERRL-------SSGQPVD-- 308

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + +r+++rl L++dlLd sr++ag
CP000113_6 309 ----------LATVLKSKRQVDRLVGLVDDLLDASRLDAG 338

CP000113_3015: domain 1 of 1, from 162 to 235: score 58.6, E = 5.1e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++fl+ +sHELRTPLt +++ + ++++ +d +a + l++e +
CP000113_3 162 IRDDFLSVASHELRTPLTPLQLKLTAMRRAVD--SAPGGMLPSERV- 205

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l+++ r+++ l +L++dlLd sri g
CP000113_3 206 ----------ERDLDVAVRQVRKLVELVDDLLDVSRISVG 235

CP000113_1222: domain 1 of 1, from 272 to 340: score 58.6, E = 5.1e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ +la+++HE R+P+ +I +++ +L+e +l + ++
CP000113_1 272 QLKMMLAGVAHEVRNPIGGIALFSGILKE----------DLQAGAHA 308

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ +e+i+re+ +l+r+++d+L ++r +
CP000113_1 309 DA--------GAHVERIQREVAYLQRIVEDFLAFAREQPL 340

CP000113_4133: domain 1 of 1, from 148 to 219: score 58.5, E = 5.4e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++a+lsHE+R+PL+a + +++L+++l l++ q++
CP000113_4 148 AVGTMTAGLSHEIRNPLNAAALQLSVLERRL-------RRLPDGQQA 187

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
p L e l +++e++rl+++++d+L+++r ++
CP000113_4 188 PLL--------EPLLLVRDEIRRLDHILEDFLQFARPREF 219

CP000113_4329: domain 1 of 1, from 397 to 463: score 57.9, E = 8.1e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +++ a+++HE+++PL++I+g+++lL d + +++
CP000113_4 397 AVGQLGAGVAHEINNPLAGILGNVQLLML--------DRGAADPD-- 433

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e l++i+++a+r+ ++ ++lL +s+ ++
CP000113_4 434 ----------LESLRKIEQSAKRCKEITQNLLRFSQQRER 463

CP000113_3330: domain 1 of 1, from 281 to 345: score 57.4, E = 1.1e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++a+++HE+++PL +I+gy+ lL++++ e +
CP000113_3 281 GIGRLAAGVAHEINNPLGVILGYVRLLQRKA-----------EGAL- 315

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l++i++e+ r++++++ +Ldlsr +
CP000113_3 316 ----------ADDLRIIEEETLRCRDIVEGMLDLSRPLQV 345

CP000113_6830: domain 1 of 1, from 545 to 607: score 57.0, E = 1.5e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak f++ +sHEL+TPL+++++ ++ L+ + r
CP000113_6 545 AKAAFFSIASHELKTPLATLKLRLQRLRP-------------DTVR- 577

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l ++r+++rl rL+n+lLd s + +g
CP000113_6 578 ----------QQDLVLMDRQVDRLARLVNQLLDVSELASG 607

CP000113_0688: domain 1 of 1, from 299 to 366: score 56.7, E = 1.8e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++fl+ ++HEL+TPLt +r+++elL++ la +++ +e
CP000113_0 299 VRDDFLSIAAHELKTPLTPLRLHLELLKR----ALAAREPIAPER-- 339

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++ +++rl++L+ndl d + eag
CP000113_0 340 -------------VDKAMAQVDRLSALVNDLVDATSVEAG 366

CP000113_5229: domain 1 of 1, from 302 to 368: score 55.4, E = 4.2e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++ +++HE+++PL +I+++a+l+ + d+ +s+ +
CP000113_5 302 AVGQLAGGVAHEINNPLGGILAFAQLMSR--------DAGRSDAD-- 338

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e l i+++a r+ r+++ lL +sr
CP000113_5 339 ----------LESLGLIEESALRCKRIVESLLKFSRHSRV 368

CP000113_0298: domain 1 of 1, from 478 to 550: score 55.1, E = 5.1e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ef++ +sHEL+TPLt +++ +++L +el +++ + + +l
CP000113_0 478 LRDEFMSIASHELKTPLTPLSLKLQALSRELA-----RHPGPVPRNL 519

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ y+ + r+++ l +L+ dlLd sri ag
CP000113_0 520 ---------VESYVAVGARQVQKLAELVGDLLDVSRISAG 550

CP000113_0554: domain 1 of 1, from 523 to 589: score 54.2, E = 9.4e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++ +sH+LR+PL+aI++ a +Ll+ e +e +
CP000113_0 523 FEQLLIGIVSHDLRNPLAAISMSATALLR---------REGLDERL- 559

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ l +il++aer r+++dlLd+++++ g
CP000113_0 560 ----------RKGLGRILSSAERATRMLRDLLDFTQARLG 589

CP000113_5051: domain 1 of 1, from 361 to 432: score 54.1, E = 9.7e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +e ++ l+HE+++PLt Ir+ +e+L++ a++++ + q
CP000113_5 361 AWQEVARRLAHEIKNPLTPIRMSLETLQA------AQEAKHPRFQ-- 399

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++e ++l+e++rl+r+++++ ++r+ +
CP000113_5 400 -------DMFKESAGVVLEEVDRLRRIVDEFSHFARMPKP 432

CP000113_6770: domain 1 of 1, from 344 to 415: score 53.8, E = 1.2e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++fl+ ++HELRTPLt +++ ++lL ++l ++++l+ e++
CP000113_6 344 VRDDFLSIAAHELRTPLTNLKLQLQLLYRQL----RREEALDVEKL- 385

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + + +r++ rl L++ lLd sr+ g
CP000113_6 386 ----------AQRVLSCERQTSRLATLVDSLLDVSRLARG 415

CP000113_1051: domain 1 of 1, from 605 to 671: score 53.0, E = 2e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++e+ a ++HE R+PL +I ++ L++ + ++
CP000113_1 605 ALGELSAIVAHEVRNPLGVIFNAVASLRR---------LLVPGGDA- 641

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +l+++ +e++rl+r++ dlLd++r + +
CP000113_1 642 ----------AMLLDILGEESDRLNRIVGDLLDYTRPRDP 671

CP000113_4086: domain 1 of 1, from 220 to 286: score 52.4, E = 3e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ + a l+HELR+PL++++g+a+lL e++ e+++
CP000113_4 220 ALGTMSAVLAHELRNPLASLKGHAQLLAERV--------ERDAVL-- 256

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++ +ea rl++L ndlL + ++
CP000113_4 257 ----------APKADRVVSEAVRLEQLMNDLLGFVASGEL 286

CP000113_0384: domain 1 of 1, from 651 to 717: score 52.3, E = 3.3e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++e+ a ++HE R+PL aI + +++ ++ +
CP000113_0 651 ALGELSAVVAHEVRNPLGAIFNSVASIRR---------IVGPDSAA- 687

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+l+++ +e++rl+r++ dlL+++r a+
CP000113_0 688 ----------VPLLDIVGEESDRLNRIVADLLTFARPPAP 717

CP000113_5839: domain 1 of 1, from 218 to 287: score 51.8, E = 4.5e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e+l +sH+++TPL a+r++ae++l+ ++++e++++
CP000113_5 218 WRDELLTVVSHDIKTPLLAVRMNAEMILN--------AGTAPEKEHR 256

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+yle i + +++++Li +lLd +r++
CP000113_5 257 ---------RRRYLENIVLAEQQMSSLIGNLLDRARLRGM 287

CP000113_0191: domain 1 of 1, from 582 to 668: score 51.6, E = 5e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++HE+++PL+ ++ ++ L +e+ + l++ + +
CP000113_0 582 SVGTLAAGIAHEINNPLAFVLSNLGFLSDEF------SRSLPPGDGA 622

peLR..l....edpeyreyletilreaerllrLindlLdlsrieag<-*
+L +l++++ +e++e l+ + + aer ++++++l ++sr +++
CP000113_0 623 AALQarLkgepDLGEWQEVLQEACEGAERVRQIVRQLKTFSRPDEE 668

CP000113_7258: domain 1 of 1, from 268 to 334: score 51.3, E = 6.3e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +++ a+l+HE+ PL + g a++L + +++l+++
CP000113_7 268 AVGQLSAGLAHEIGSPLLILNGRAQALAA--------RADLPDDV-- 304

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ +++ +++er++r++++lLdl+r
CP000113_7 305 ----------RRNARILVEQSERIERIVRQLLDLARRKPS 334

CP000113_2694: domain 1 of 1, from 155 to 228: score 51.0, E = 7.7e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++HE+++PL+ ++ +++ L+e l+ +els eq+
CP000113_2 155 SIGTLAAGVAHEINNPLSYVSSNLSYLRE-----LLAQPELSHEQL- 195

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e re + +++ a r +++++dl+++sr++++
CP000113_2 196 -------MELREVVAEAQEGAGRVSAIVRDLRTFSRADEE 228

CP000113_4858: domain 1 of 1, from 307 to 369: score 50.7, E = 9.1e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++f+++++HE R+PL ++ ++++lL++ ++++
CP000113_4 307 ELGQFTSAVAHEVRNPLGVLAAHLKLLER---------RGGDPDT-- 342

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++++++r ++ +++lL + r +
CP000113_4 343 -------------VAAMREQIDRASHFVDELLRYGRPRPL 369

CP000113_0335: domain 1 of 1, from 619 to 687: score 50.5, E = 1e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e ++ +sH+LR+PL++I++ + lL++ l e++ e
CP000113_0 619 LREEYVSLISHDLRNPLHTISLRVGLLRRAL-------REQNLERE- 657

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++e i+r++ ++ +i+dlL+ sr+e++
CP000113_0 658 ----------ESMTEAIQRSVAWMNTMIEDLLEGSRLESQ 687

CP000113_1103: domain 1 of 1, from 283 to 352: score 50.4, E = 1.1e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f a ++H+L++P++a++g+a+ L+e + ++ + q
CP000113_1 283 TLGRFSAQMAHDLKNPIAAMKGAAQYLKE-----EHARGRSWDGQ-- 322

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+l+ +l+++erl+r ++ l+r e
CP000113_1 323 ----------GEFLDLLLEQVERLDRVVDTYQRLARVEPL 352

CP000113_0443: domain 1 of 1, from 243 to 316: score 50.1, E = 1.3e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++a++ HELR+PL+a+r L ++l t ++ +
CP000113_0 243 AVGQLAASVGHELRNPLAAVRNSHAYLSRKL-------TRDPAGAA- 281

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
dp + ++l ++re++ + ++i+dlLd++r + +
CP000113_0 282 -----DDPRVPQFLGLMERELNACAKIISDLLDFARERPP 316

CP000113_5864: domain 1 of 1, from 328 to 394: score 50.0, E = 1.4e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e + ++HE R+PL aI+ ++ +L++ +++l++
CP000113_5 328 VLGEAAGVVAHEVRNPLGAILNAVAVLRR--------EAHLGPTG-- 364

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++ +++ea rl+++++dlLd r ++
CP000113_5 365 ----------QAAVGMLEEEAIRLEDIVRDLLDVVRPLEP 394

CP000113_0625: domain 1 of 1, from 330 to 397: score 49.9, E = 1.5e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++fl+ +sHEL+TPLt +++ + +L+++l + +
CP000113_0 330 VRDDFLSIASHELKTPLTPLSLRLATLERRL-------ARGELVE-- 367

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l+ ++ + r+ +LindlLd srieag
CP000113_0 368 ----------SSTLRQARLYLLRITSLINDLLDSSRIEAG 397

CP000113_0057: domain 1 of 1, from 521 to 588: score 49.8, E = 1.6e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
e++ ++H+L +PL+++++++ L++ el eeq++
CP000113_0 521 DAVELIGVAAHDLGNPLNTLQLLLRRLQR---------MELAEEQKA 558

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ l +l++++rl +L+ +lLdlsr+ +g
CP000113_0 559 ----------RDGLAAALKQTQRLGQLLHNLLDLSRLSSG 588

CP000113_7189: domain 1 of 1, from 306 to 378: score 49.6, E = 1.9e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
++efl +sHEL+TPLt +++ +++L + ++ ++++ e +
CP000113_7 306 LRDEFLTVASHELKTPLTPLSLKLQTLAR----AtQERRGPELLERL 348

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
le+++r+++rl+ L+ +lLd + i +g
CP000113_7 349 -----------PADLEVMQRQVKRLSTLVGELLDVTLISSG 378

CP000113_7219: domain 1 of 1, from 776 to 845: score 49.3, E = 2.2e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++e+l+ + HEL+ PL+a+++ ++lL + ++++ + +
CP000113_7 776 ARDELLSVAGHELKSPLNALQLQIHLLAR------MAREAMAVDGL- 815

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e e++ ++++rl Li+dlLd sr+ +g
CP000113_7 816 ----------AERAERAAKAGQRLGLLIDDLLDVSRLSSG 845

CP000113_3868: domain 1 of 1, from 457 to 532: score 49.0, E = 2.7e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++a+++HE+++PL+ ++ +++ L el ++l +e
CP000113_3 457 AVGTLAAGVAHEINNPLAFVLSNLSFLAGEL-------HALAPEL-- 494

peLR...ledpeyreyletilreaerllrLindlLdlsrieag<-*
p +R +l +e l+ + + a+r +++++dl+++sr + +
CP000113_3 495 PSGRmaeL-----EEVLREATDGAHRVRQIVRDLRTFSRGDDE 532

CP000113_4520: domain 1 of 1, from 326 to 391: score 48.2, E = 4.5e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+e +a sH+LR PL +++g+ lL+e ++l ++q
CP000113_4 326 LKDEIIAVCSHDLRAPLQVLLGHGRLLQE---------GPLEPQQ-- 361

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ e ++r+++ +l L++ lL+ + ea
CP000113_4 362 ----------RQSSEAMIRQGKKILGLVESLLEKGKGEAA 391

CP000113_6950: domain 1 of 1, from 309 to 378: score 47.7, E = 6.2e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++efla + HEL+TPLta+++ ++ L a + + +
CP000113_6 309 RRDEFLALAGHELKTPLTALQLQLQSLPS------AAARKDGGGRL- 348

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e l++++r +erl i+ lLd sri++g
CP000113_6 349 ----------LERLDKAIRHTERLATHIDGLLDVSRIGEG 378

CP000113_1645: domain 1 of 1, from 192 to 255: score 46.5, E = 1.4e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + f +++sHELRTPL++ +g++e+L+ d++++ e+
CP000113_1 192 RERAFNRDASHELRTPLAVAQGAVEILEL--------DPPADTET-- 228

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++++++++ L + +L l+r +
CP000113_1 229 -------------FGRLRQAIHHMGLLTEGILWLARSGRS 255

CP000113_6678: domain 1 of 1, from 220 to 286: score 45.8, E = 2.2e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++ + H++RTPL++++++a+ l+ +++l + q
CP000113_6 220 LEQQLMGIVGHDIRTPLSVVLTTAKSQLA--------SGALEPAQ-- 256

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++e++ r++er++++++ l d++r + g
CP000113_6 257 ----------QKAFERVARSGERIQHIVDLLTDFTRSRLG 286

CP000113_0240: domain 1 of 1, from 461 to 533: score 45.4, E = 2.8e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++efl+ +sHEL+TPLt++ + ++ + + +++ +
CP000113_0 461 ARDEFLSVASHELKTPLTSLGLRLQSFVR---------AIHADPESA 498

peLR...ledpeyreyletilreaerllrLindlLdlsrieag<-*
+ R++++ +e ++r++ rl +L++ lLd sri +g
CP000113_0 499 LAQRhgrE--------VEAMRRQVTRLAELVDGLLDVSRISTG 533

CP000113_3362: domain 1 of 1, from 237 to 303: score 45.0, E = 3.7e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++++a ++HELRTPL+ +r+ ++l+l+ e+++e++
CP000113_3 237 AQERLIARAAHELRTPLALMRTGLDLALR---------RERGAEEL- 273

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r le +re++rl + lL+ls ++
CP000113_3 274 ----------RTVLEENRREVDRLASVAGALLELSAAGGA 303

CP000113_2302: domain 1 of 1, from 659 to 732: score 44.9, E = 4e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++efl+ +sHEL+TP+t++++ ++ L + l + ++++ l+ e++
CP000113_2 659 ARDEFLSIASHELKTPVTSMKLRVQQLTRTLSR--QESGQLPVEKV- 702

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +l++ ++++rl++L++ lLd sr +
CP000113_2 703 ----------AALLDVFGDQLRRLSHLVEHLLDVSRVNER 732

CP000113_2959: domain 1 of 1, from 287 to 359: score 44.9, E = 4e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++a++sHELR+PL+a r++ + + + +l+ +
CP000113_2 287 AVGRMTATVSHELRNPLAAARTANAVVVR-------HLRKLDVTLAD 326

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+L +++le+i+re+ ++r+ ++lLd++r +
CP000113_2 327 QRL-------QRFLEIIERELAVCSRISSELLDFARERPL 359

CP000113_0328: domain 1 of 1, from 335 to 407: score 44.5, E = 5.3e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++e+la +sHEL+ PL+a+++ ++ L++ l+ +++++ + +rl
CP000113_0 335 AREELLAIASHELKSPLSALQLQVQNLRTALE----RSPDAVPRERL 377

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l+ + r+a+r +Li+ lLd sri ag
CP000113_0 378 HRG----------LDLMGRQAKRQAKLIDALLDVSRIHAG 407

CP000113_0594: domain 1 of 1, from 484 to 560: score 43.7, E = 8.6e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ ++a+++HEL++PL+ ++ +++ L + +
CP000113_0 484 SMGLLAAGIAHELNNPLAYVLSNLDFLHS---------AVGGVRP-- 519

peLR.l...edpeyreyletilreaerllrLindlLdlsrieag<-*
R l+++ e r+ l+ +++ aer+++++++l+ +sr e g
CP000113_0 520 ---RmLspeDMVELRQVLDDAREGAERMRQIVRQLRVFSRVEDG 560

CP000113_4140: domain 1 of 1, from 476 to 542: score 43.1, E = 1.3e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ +a+++HE R+PL +I++ +++ ++ t ++
CP000113_4 476 AMGAIVAGVAHEVRNPLFSISAVVDAVEA---------TFGARAEL- 512

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ y+++++ e++rl++L ++l ++ r g
CP000113_4 513 ----------KPYVDVLRGEVKRLNHLTQELFEYGRPTRG 542

CP000113_6696: domain 1 of 1, from 411 to 481: score 42.9, E = 1.5e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++a++ HE+++P+ta+ +ya++Ll ++ +++ ++
CP000113_6 411 SIGQLAASVVHEINNPMTAVATYADALLQ--------RSRMTPGANP 449

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e l++il++++r+lr +dl ++r +
CP000113_6 450 AD--------QEKLRKILESSHRILRFTRDLVSYARPAQD 481

CP000113_3708: domain 1 of 1, from 222 to 287: score 42.7, E = 1.7e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ + ++HEL++PL++++g+++l+ +e+ + + + +r
CP000113_3 222 ALEAMSGEIAHELKNPLATVKGLTQLMAREA-------GRAQPAER- 260

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l+++ e+ r++ +++++L ++r +
CP000113_3 261 -------------LQVLSGEVVRMQGILEEFLNFTRPLVP 287

CP000113_4903: domain 1 of 1, from 294 to 368: score 42.4, E = 2.1e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++ a + HE R+PL++I +++elL+++++ +a+ ++ +
CP000113_4 294 AVGRISAQIVHEVRNPLSSIGLNVELLQDGFE--TARFATPEDAA-- 336

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e++++++ + +e++rl + ++ L ++r +
CP000113_4 337 --------EVKDLISAVTQEVDRLADVTEQYLRMARPPRP 368

CP000113_0716: domain 1 of 1, from 380 to 448: score 41.7, E = 3.3e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
e++ ++H+L +PL+++++ + L + ++ ++++rl
CP000113_0 380 DALELIGIAAHDLGNPLSSLQLRLRRLSM--------QSAGTSDTRL 418

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ l ++ e++rl rL+ +lLdlsr+ ag
CP000113_0 419 ----------RDGLAGAEGETRRLGRLVHNLLDLSRLSAG 448

CP000113_4350: domain 1 of 1, from 47 to 109: score 41.2, E = 4.4e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
s+++a + HELR+PL ++++ya+lL e + + +
CP000113_4 47 HTSQLAAEVLHELRQPLLGVKAYAQLLAE---------DGAAPGP-- 82

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l+ +l ++er++++++d+ ls +
CP000113_4 83 -------------LRLLLAQVERMEQIVSDFIRLSSERPA 109

CP000113_1163: domain 1 of 1, from 203 to 273: score 40.9, E = 5.3e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++ +++l+HEL++PLta+++ + L + + +t+ + +
CP000113_1 203 AWQDVARALAHELKNPLTAMKLSLARLNR-----TDASTPHDTTRI- 243

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e++ +++e++ l r+ + + +++r+ a+
CP000113_1 244 ----------TEAVALLQEEVDLLMRMTQSFSTFARLPAP 273

CP000113_6697: domain 1 of 1, from 587 to 653: score 40.8, E = 5.8e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ +++HEL++PLt+++gyaelL+++l + ++
CP000113_6 587 VIVALAGTAAHELNQPLTSVMGYAELLKRKL--------KEDDFA-- 623

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++i+reaer+ ++++ + ++r e+
CP000113_6 624 ----------WKPVDIIYREAERMAEIVRKIGKITRYETK 653

CP000113_2618: domain 1 of 1, from 100 to 158: score 40.6, E = 6.4e-11
*->lsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrlpeLRledp
+sH+LRTPL +I+gy++++l++ + l+++
CP000113_2 100 ASHDLRTPLMVIKGYVDMMLKGTA------GGLTAPI---------- 130

eyreyletilreaerllrLindlLdlsrieag<-*
++yle+++r+a+ +++i++ l++ + +
CP000113_2 131 --QRYLERLRRSADDQSAIIER--RLAKVQDE 158

CP000113_0903: domain 1 of 1, from 91 to 165: score 40.5, E = 6.9e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++ +a++ HE+++PL+ I+ ++e + el ++ ++lse++r
CP000113_0 91 ALGRIAAGVGHEINNPLAFILSNLEYIHQEL----QQKEHLSEQDR- 132

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+ e+l ++ aer++ +++dl +lsr+e
CP000113_0 133 -------QEVLEALAETRDGAERIRLIVRDLQTLSRAEDV 165

CP000113_0906: domain 1 of 1, from 406 to 481: score 40.2, E = 8.8e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + + a+++HE+++PL+ ++ +++l++e+l+++ + ++++ +
CP000113_0 406 SVGTLGAGVAHEINNPLAYMLVNLHLIREGLERLESQAPAAPVASL- 451

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++++ + aer+ +++dl ++r e++
CP000113_0 452 ----------QQLVRETAEGAERIATIVRDLKVFARGEQE 481

CP000113_4991: domain 1 of 1, from 128 to 194: score 40.0, E = 9.8e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ s++ ++lsHE+R+PL+++++++++L ++ t l++ +
CP000113_4 128 QISRLSSSLSHEIRNPLSSVKMAVQTLARN--------TGLNDRD-- 164

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l ++ re++ ++r++ l ++ r ++
CP000113_4 165 ----------KRRLTIANREIRTMERMLWLLSEYGRDTTP 194

CP000113_4151: domain 1 of 1, from 473 to 539: score 39.7, E = 1.2e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++a+++HE+ TPL ++rg ae l +l + +q
CP000113_4 473 TVGVLAAGIAHEIGTPLGVVRGRAEYVLGKL--------GREHPQ-- 509

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +i+++++r +r +++lLd+sr++
CP000113_4 510 ----------GPGIAVIIEQIDRVSRTLRQLLDFSRLQPT 539

CP000113_5845: domain 1 of 1, from 234 to 297: score 37.3, E = 5.6e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++ la+++H+L+TP++++++ +el+ + + +e++
CP000113_5 234 ALERHLADVAHDLKTPIASLQLSLELAST----------TPTEPT-- 268

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +l+ ++++ +l +L+++ L l+ +
CP000113_5 269 ----------AALLRQGIEDTVYLTSLVDN-LHLACQLGE 297

CP000113_4461: domain 1 of 1, from 480 to 546: score 37.0, E = 7e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++a+++HE+ TPL +rg ae +e +l+ e+ +
CP000113_4 480 TVGVLAAGIAHEIGTPLGIVRGRAEYVQE----------KLGREHPQ 516

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l ti +++r +r +++lLd+sr++
CP000113_4 517 AAG----------LGTIVGQIDRVSRTLRQLLDFSRLRPA 546

CP000113_5077: domain 1 of 1, from 266 to 324: score 36.9, E = 7.5e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f+an++HELRTP++ + + ++ L +
CP000113_5 266 RQQLFVANAAHELRTPVAILCARLDSLGD------------------ 294

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ ++r+a rl ++++lL r++ +
CP000113_5 295 ----------SPATRDLRRDATRLGLMVDQLLAAFRMQGQ 324

CP000113_2320: domain 1 of 1, from 388 to 470: score 36.1, E = 1.2e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++HE+++PL+ + +++ ++eel + l+ +r
CP000113_2 388 SVGTLAAGVAHEINNPLAYLTANLAFAREELT------GVLPTGTRN 428

peLR..ledpeyreyletilreaerllrLindlLdlsrieag<-*
e R + + + +l +++ a+r +++++dl ++sr ++
CP000113_2 429 MEPRlaEAVASAQAALAEAQQGADRVRSIVRDLKTFSRVDSA 470

CP000113_6784: domain 1 of 2, from 265 to 326: score 35.4, E = 2e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++++ + H++R PL aI+ + +L + + +e+
CP000113_6 265 FQEQLMGIVTHDIRSPLGAIMNWSRVLAA---------GGTDEDA-- 300

peLRledpeyreyletilreaerllrLindlLdlsr<-*
++ ++i +a r++rL + lLd++r
CP000113_6 301 ----------QRTSQRIATAAVRIERLTRLLLDFTR 326

CP000113_2884: domain 1 of 1, from 106 to 173: score 34.2, E = 4.4e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ + l+++sH+LR L+ +r ya lLl+ g+ +l ++
CP000113_2 106 RRVRYLSMASHDLRGSLANVRSYAALLLN-------GRVPLEPKV-- 143

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ letilr a+r l+ +d+ d sr++ g
CP000113_2 144 ----------QRGLETILRNADRSLAFSQDFFDASRADLG 173

CP000113_5703: domain 1 of 1, from 756 to 822: score 33.8, E = 5.4e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++ +a+++HE+ +PLtaI +++ L+ el+ +++ ++r
CP000113_5 756 SLGRVAAGVAHEIGNPLTAIASLTQNLKYELE------DPAAVQER- 795

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
il++ +r++++++ l +s ++
CP000113_5 796 -------------AGLILQQCRRIDAIVRTLVGFSHEGTV 822

CP000113_0308: domain 1 of 1, from 319 to 399: score 33.2, E = 8e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++a++ HE+++PL+ + g+++ +le l + ++
CP000113_0 319 MAGQLAAGVGHEINNPLSYVVGNLQFALE----------QLEPLATQ 355

peLR..l..edpeyreyletilreaerllrLindlLdlsrieag<-*
++ R++l + +e e+l+ +++ aer++ ++dl ++r+e++
CP000113_0 356 GAVResLarALGEAMEALREAKEGAERIRTTVRDLQIFARAEEP 399

CP000113_6068: domain 1 of 1, from 205 to 270: score 32.9, E = 9.7e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++s ++a+++HEL TPL +I +a L + l ++q
CP000113_6 205 SLSTLAAGAAHELGTPLGTIAIAANELDA---------LILEAPQ-- 240

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e e + i++e+er++++++++ +r+++
CP000113_6 241 --------EALEDARLIRDEVERCRDILERM--SARAGQT 270

CP000113_5556: domain 1 of 1, from 268 to 334: score 31.6, E = 2.3e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++++ l H+LR PL+a+ + ++ ++ e + + +l
CP000113_5 268 DKEQLTEFLVHDLRSPLSALTLSLSWMEQ----------EVPQQGIL 304

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e ++t l + rl+r+i+dl+d r+e+g
CP000113_5 305 ----------GESVRTGLAVTARLDRMISDLMDVPRLEEG 334

CP000113_4135: domain 1 of 1, from 170 to 237: score 31.3, E = 2.9e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++ ++ HELR+PL +I + + +L+ + ++++e +
CP000113_4 170 TFGQLVGSIGHELRNPLGVIETSLYILRG-------RPGAMDERT-- 207

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l++i +++ +r+++dlLd+ r +
CP000113_4 208 ----------TKHLDRIGDQVGIANRIVSDLLDMIRDRPL 237

CP000113_3773: domain 1 of 1, from 348 to 414: score 31.0, E = 3.4e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++ +++H++++ L +I+g+++lL + + q+
CP000113_3 348 AVGKLTGGVAHDFNNLLQVISGNLQLLFL---------DVGDNAQA- 384

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l t+ ++er rL ++lL ++r +
CP000113_3 385 ----------QRRLTTAVGAVERGARLASQLLAFARRQPL 414

CP000113_7033: domain 1 of 1, from 843 to 923: score 30.6, E = 4.5e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
a ++++a++ HE+++PL+ I ++e + ee+d + d++++ r
CP000113_7 843 AVGQLAAGVGHEINNPLAYIVSNLEHASEEADALaRELDGTRDVGAR 889

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l+ ++l+ +l a+r +r+++dl +sr + +
CP000113_7 890 LKDV-------NQALRDALLGADRVRRIVQDLKMFSRPDDE 923

CP000113_6807: domain 1 of 1, from 216 to 281: score 29.4, E = 9.8e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ ++a+++HEL TPL++I ++ ++ l t+ ++e +
CP000113_6 216 SLATLAAGAAHELSTPLSTIAVVTKEVERALA------TAGTSESV- 255

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re l+ i+++++r+++ + ++ ++ag
CP000113_6 256 ----------REDLRLIRQQVDRCRDVLVQM----SADAG 281

CP000113_6686: domain 1 of 1, from 451 to 522: score 29.0, E = 1.2e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++a++ HE+++PL+ + +++e+++++l + + ++
CP000113_6 451 AVGTLAAGVGHEINNPLAYLVLNLEAAERGL-------SQGGMSGMR 490

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + +l+ aer++ +++dl +sr +++
CP000113_6 491 DA--------MANMRGALEGAERIRLIVRDLQVFSRQGNQ 522

CP000113_1140: domain 1 of 1, from 232 to 299: score 27.8, E = 2.7e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f++ ++H+L PL+ ++gy+ l+++ ++ ++ +
CP000113_1 232 ELDAFTRRVAHDLISPLAPLKGYLTLIRR--------TGAVNDAGA- 269

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+l +++a r+ +Li+ lL + r+++
CP000113_1 270 ----------LEMLAQCESSAVRMGELIEALLRFCRAGTR 299

CP000113_2539: domain 2 of 2, from 731 to 801: score 27.3, E = 4e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
a + ++++ +HE R+PL++++ ++ L++ ++g+++ +
CP000113_2 731 AIGLLTSGFAHEVRNPLNGLMNALLPLKD----MlTGGSADVELSK- 772

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+le+++++++r+++L + lL ++r +
CP000113_2 773 ------------AMLEVVEECGQRIRHLAESLLSFTRTSES 801


Histogram of all scores:
score obs exp (one = represents 23 sequences)
----- --- ---
-15 4 0|=
-14 28 0|==
-13 73 5|*===
-12 259 167|=======*====
-11 601 869|=========================== *
-10 1113 1612|================================================= *
-9 1322 1664|==========================================================*
-8 1311 1246|======================================================*==
-7 1004 785|==================================*=========
-6 626 452|===================*========
-5 379 248|==========*======
-4 223 132|=====*====
-3 120 70|===*==
-2 59 36|=*=
-1 34 19|*=
0 24 10|*=
1 9 5|*
2 4 2|*
3 9 1|*
4 2 0|=
5 4 0|=
6 0 0|
7 1 0|=
> 8 122 -|======


% Statistical details of theoretical EVD fit:
mu = -8.9758
lambda = 0.6525
chi-sq statistic = 1530.0502
P(chi-square) = 0

Total sequences searched: 7331

Whole sequence top hits:
tophits_s report:
Total hits: 113
Satisfying E cutoff: 113
Total memory: 24K

Domain top hits:
tophits_s report:
Total hits: 114
Satisfying E cutoff: 114
Total memory: 67K


Acknowledgements:

This research is funded by:

Developed by: