Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
39 projects found  

5 accessions found for Anabaena variabilis ATCC 29413  

Data for CP000117  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000117.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000117_0064 CDS_85761-80617 174.6 1.4e-49 1
CP000117_4297 CDS_5415312-5420276 164.1 2e-46 1
CP000117_2988 CDS_3728162-3725337 141.8 4.7e-40 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000117_0064 1/1 1521 1607 .. 1 94 [] 174.6 1.4e-49
CP000117_4297 1/1 1459 1545 .. 1 94 [] 164.1 2e-46
CP000117_2988 1/1 749 835 .. 1 94 [] 141.8 4.7e-40

Alignments of top-scoring domains:
CP000117_0064: domain 1 of 1, from 1521 to 1607: score 174.6, E = 1.4e-49
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSLLr+Q+r++ de + l ++ EsqnRV+S
CP000117_0 1521 EIHHRVKNNLQIISSLLRMQSRRSFDETT-----LLLFTESQNRVQS 1562

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+s d+ +++fs+Y+++Lt++Lf++ygv+ ++i+++ +
CP000117_0 1563 MALIHEQLYQSADINQINFSDYIKNLTDSLFRCYGVSQKNIRIN--I 1607

CP000117_4297: domain 1 of 1, from 1459 to 1545: score 164.1, E = 2e-46
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNL ++SSLL +Q+r+++d+ + ++Lr+sqnR++S
CP000117_4 1459 EIHHRVKNNLGIVSSLLQMQCRRTQDPQA-----NAILRDSQNRIAS 1500

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al HE+LY+s dl ++df++Y+ Lt +Lf+sy+v+s+ i+L+ +
CP000117_4 1501 IALAHEKLYRSNDLANIDFAQYIPDLTTHLFDSYNVKSSCIQLS--I 1545

CP000117_2988: domain 1 of 1, from 749 to 835: score 141.8, E = 4.7e-40
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ++S+LL L+++ kd+e + L+EsqnR+ S
CP000117_2 749 EVHHRVKNNLQIVSGLLLLHSQTLKDPEL-----IRTLQESQNRIES 790

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+++iH+ LY+s +++++d+ +Y+++L+ +++ sy+++ ++isL+ +
CP000117_2 791 ISMIHKNLYTSPNIGQLDVVDYVNNLATSILISYQLEPGRISLE--T 835


Histogram of all scores:
score obs exp (one = represents 21 sequences)
----- --- ---
-15 5 0|=
-14 21 0|=
-13 55 31|=*=
-12 249 330|============ *
-11 1235 921|===========================================*===============
-10 980 1192|=============================================== *
-9 880 1007|========================================== *
-8 642 675|=============================== *
-7 345 401|================= *
-6 321 223|==========*=====
-5 127 120|=====*=
-4 90 63|==*==
-3 46 33|=*=
-2 17 17|*
-1 9 9|*
0 5 4|*
1 4 2|*
2 2 1|*
3 2 0|=
> 4 4 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 266.2598
P(chi-square) = 0

Total sequences searched: 5039

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: