hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000117.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000117_2023 CDS_2509590-2510795 98.7 1.1e-28 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000117_2023 1/1 203 270 .. 1 70 [] 98.7 1.1e-28
Alignments of top-scoring domains:
CP000117_2023: domain 1 of 1, from 203 to 270: score 98.7, E = 1.1e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HDs+g+sL+a++lqle+a++l+ +++p +a++ l ++
CP000117_2 203 ERNRIAREIHDSLGHSLTALNLQLETALKLA--QSNPNKAQTFLVRA 247
relarealaevRrllgdLRpaal<-*
+el+++al++vR+ ++++R l
CP000117_2 248 KELGSKALQDVRNSVSTMRSHPL 270
Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-14 22 0|==
-13 112 0|=======
-12 210 56|===*=========
-11 331 461|==================== *
-10 812 1071|================================================ *
-9 967 1216|========================================================= *
-8 728 937|=========================================== *
-7 637 589|==================================*===
-6 389 333|===================*===
-5 390 178|==========*============
-4 183 93|=====*=====
-3 112 48|==*====
-2 67 24|=*==
-1 34 12|*=
0 17 6|*
1 7 3|*
2 9 1|*
3 2 0|=
4 1 0|=
5 3 0|=
6 3 0|=
7 0 0|
8 0 0|
9 1 0|=
> 10 2 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1178.9177
P(chi-square) = 0
Total sequences searched: 5039
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K