Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

7 accessions found for Rhizobium etli CFN 42  

Data for CP000133  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000133.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000133_3235 CDS_3438060-3439013 139.2 3.1e-47 1
CP000133_3560 CDS_3817991-3819643 74.9 2.4e-25 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000133_3235 1/1 120 202 .. 1 85 [] 139.2 3.1e-47
CP000133_3560 1/1 357 438 .. 1 85 [] 74.9 2.4e-25

Alignments of top-scoring domains:
CP000133_3235: domain 1 of 1, from 120 to 202: score 139.2, E = 3.1e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KN+LA++Q+ia+QT+Rn+ sld+f+ +F+gRLq+Ls+++dL
CP000133_3 120 ELSHRSKNLLAIIQGIATQTARNTLSLDSFLLKFRGRLQSLSNSQDL 166

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t+s+W+gA L+eL+e ++aPy++e ++ + G +
CP000133_3 167 --VTDSSWRGAYLFELAEKQFAPYWPETSGSMPIYGIN 202

CP000133_3560: domain 1 of 1, from 357 to 438: score 74.9, E = 2.4e-25
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR KN+L++ Q+++rQ +++a+s++ f +a++ RL L r+ L
CP000133_3 357 ELVHRTKNLLTLAQAMMRQLAKQADSVETFQAAVANRLEGLVRSIEL 403

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt ++W+g++Lr ++ + L+++ + +e+i+++G+d
CP000133_3 404 --LTSEQWGGVSLRRVVDIHLQAFPQS-REQIEITGED 438


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 4 0|=
-13 31 0|===
-12 329 0|==========================
-11 419 32|==*==============================
-10 624 417|================================*===============
-9 741 1032|========================================================= *
-8 731 1072|========================================================= *
-7 479 720|===================================== *
-6 261 393|===================== *
-5 189 194|==============*
-4 104 92|=======*
-3 55 42|===*=
-2 27 19|=*=
-1 22 9|*=
0 8 4|*
1 4 1|*
2 2 0|=
3 0 0|
4 0 0|
> 5 5 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4964.0127
P(chi-square) = 0

Total sequences searched: 4067

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: