Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

7 accessions found for Rhizobium etli CFN 42  

Data for CP000136  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000136.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000136_0157 CDS_169973-168588 69.1 2.6e-21 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000136_0157 1/1 250 317 .. 1 70 [] 69.1 2.6e-21

Alignments of top-scoring domains:
CP000136_0157: domain 1 of 1, from 250 to 317: score 69.1, E = 2.6e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD+++Q+L +++ ++la r + +++ + a++++++
CP000136_0 250 ERTRLARELHDGISQTLLGVRYAMDLAGRKV--RTNVDDAAQTIERG 294

relarealaevRrllgdLRpaal<-*
e+++ a++e+R l +dLRp +l
CP000136_0 295 VEALNGAIKEIRLLSHDLRPRVL 317


Histogram of all scores:
score obs exp (one = represents 1 sequences)
----- --- ---
-12 4 2|=*==
-11 11 21|=========== *
-10 28 49|============================ *
-9 52 56|==================================================== *
-8 38 43|====================================== *
-7 27 27|==========================*
-6 18 15|==============*===
-5 24 8|=======*================
-4 10 4|===*======
-3 8 2|=*======
-2 3 1|*==
-1 4 0|====
0 3 0|===
1 0 0|
> 2 2 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 45.6848
P(chi-square) = 3.421e-08

Total sequences searched: 234

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: