Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

7 accessions found for Rhizobium etli CFN 42  

Data for CP000138  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000138.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000138_0079 CDS_82176-83849 86.1 5.1e-30 1
CP000138_0076 CDS_75537-79511 73.7 8.4e-26 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000138_0079 1/1 362 442 .. 1 85 [] 86.1 5.1e-30
CP000138_0076 2/2 1117 1202 .. 1 85 [] 72.8 1.7e-25

Alignments of top-scoring domains:
CP000138_0079: domain 1 of 1, from 362 to 442: score 86.1, E = 5.1e-30
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HRVKN +++VQ+iarQT +++s +e +F+ RL+AL+++ dL
CP000138_0 362 ELAHRVKNGFTLVQAIARQT--FSRSDPERYSSFAERLAALAGTYDL 406

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+ +e+ +r++l+a+L+++ + +a+Ri+l+GPd
CP000138_0 407 --ILSREGLASPIRDILSAALRAHVASQADRIRLDGPD 442

CP000138_0076: domain 2 of 2, from 1117 to 1202: score 72.8, E = 1.7e-25
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N++AvV S+a T R++++l++f+e+F++RL L+r+++L
CP000138_0 1117 ELQHRTRNLMAVVRSMAEKTMRTSTDLADFHERFRDRLDVLARVQGL 1163

VpLtr.seWagAdLreLleaeLaPygged..aeRitlsGPd<-*
L+r e+ ++ +L+++eLa++g ++ Ri l+GPd
CP000138_0 1164 --LSRlQEGDRITFDQLIRSELAAHGMLEgeNSRISLQGPD 1202


Histogram of all scores:
score obs exp (one = represents 2 sequences)
----- --- ---
-13 3 0|==
-12 37 0|===================
-11 55 4|=*==========================
-10 86 58|============================*==============
-9 92 145|============================================== *
-8 102 150|=================================================== *
-7 79 101|======================================== *
-6 42 55|===================== *
-5 29 27|=============*=
-4 17 12|=====*===
-3 10 6|==*==
-2 6 2|*==
-1 1 1|*
0 2 0|=
> 1 6 -|===


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 59.9474
P(chi-square) = 1.546e-10

Total sequences searched: 573

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: