Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

1 accessions found for Pelobacter carbinolicus DSM 2380  

Data for CP000142  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000142.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000142_2885 CDS_3165975-3163741 139.9 1.1e-39 1
CP000142_0327 CDS_376807-380526 122.6 9.2e-35 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000142_2885 1/1 553 641 .. 1 94 [] 139.9 1.1e-39
CP000142_0327 1/1 1048 1116 .. 1 74 [. 122.6 9.2e-35

Alignments of top-scoring domains:
CP000142_2885: domain 1 of 1, from 553 to 641: score 139.9, E = 1.1e-39
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQv+SSLL LQa+k d+e+ + ++ Esq+R+ S
CP000142_2 553 EIHHRVKNNLQVVSSLLYLQAQKLHDPEA-----KTLFAESQSRICS 594

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl HE+LY+s++l ++ + +Y++ L+++ +q+++ + i+ k+D+
CP000142_2 595 MALAHEQLYQSKNLADISLLDYVQSLVSHVKQTFMSPQSVIDCKVDV 641

CP000142_0327: domain 1 of 1, from 1048 to 1116: score 122.6, E = 9.2e-35
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQv+SSLL LQ++kf+d e ++ + Esq+R+ S
CP000142_0 1048 EIHHRVKNNLQVVSSLLYLQSQKFSDAEL-----QNCFLESQSRICS 1089

mAliHEeLYksedldtvdfseYlekLt<-*
mA+ HE+LY+s++l ++ ++ Yle+L+
CP000142_0 1090 MAIAHEQLYQSKNLADISIKTYLENLV 1116


Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-15 7 0|=
-14 17 0|==
-13 74 20|=*===
-12 194 220|============= *
-11 834 613|========================================*===============
-10 694 793|=============================================== *
-9 544 670|===================================== *
-8 407 449|============================ *
-7 212 267|=============== *
-6 189 148|=========*===
-5 79 80|=====*
-4 43 42|==*
-3 30 22|=*
-2 7 11|*
-1 11 6|*
0 2 3|*
1 2 1|*
2 3 0|=
> 3 4 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 287.6105
P(chi-square) = 0

Total sequences searched: 3353

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: