Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

7 accessions found for Rhodobacter sphaeroides 2.4.1  

Data for CP000143  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000143.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000143_0817 CDS_844698-848210 96.2 9.5e-33 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000143_0817 1/1 964 1044 .. 1 85 [] 96.2 9.5e-33

Alignments of top-scoring domains:
CP000143_0817: domain 1 of 1, from 964 to 1044: score 96.2, E = 9.5e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKN L++V ++++ +R ++++e +e++++R++AL+++H+L
CP000143_0 964 ELQHRVKNMLSNVIALVNRARREQGDPQEILETLAQRIRALANTHNL 1010

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt ++Wa+ +L+++ + eL g +eR+tl GP+
CP000143_0 1011 --LTSENWASTSLSDIFALELLNVYG--EERVTLRGPE 1044


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 2 0|=
-13 35 0|====
-12 197 0|====================
-11 248 24|==*======================
-10 380 312|===============================*======
-9 553 773|======================================================== *
-8 550 802|======================================================= *
-7 412 539|========================================== *
-6 253 294|========================== *
-5 163 145|==============*==
-4 91 69|======*===
-3 57 32|===*==
-2 31 14|=*==
-1 15 6|*=
0 15 3|*=
1 7 1|*
2 1 0|=
3 4 0|=
4 1 0|=
5 0 0|
> 6 7 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2268.2090
P(chi-square) = 0

Total sequences searched: 3022

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: