Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

7 accessions found for Rhodobacter sphaeroides 2.4.1  

Data for CP000145  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000145.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000145_0057 CDS_70301-71737 117.9 1.3e-41 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000145_0057 1/1 290 372 .. 1 85 [] 117.9 1.3e-41

Alignments of top-scoring domains:
CP000145_0057: domain 1 of 1, from 290 to 372: score 117.9, E = 1.3e-41
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+V+Si r T +++++l+ + aF++R+qAL+++H+L
CP000145_0 290 ELDHRVKNTLALVMSISRRTMHSEETLEGYQKAFTARIQALAATHNL 336

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + +W+ ++r++l +eLaPy+ ++Ri ++ Pd
CP000145_0 337 --LADKSWSDISIRDVLVRELAPYNEGFSQRILVEVPD 372


Histogram of all scores:
score obs exp (one = represents 1 sequences)
----- --- ---
-12 5 0|=====
-11 7 0|=======
-10 17 10|=========*=======
-9 16 25|================ *
-8 24 26|======================== *
-7 10 17|========== *
-6 10 9|========*=
-5 3 4|===*
-4 2 2|=*
-3 2 1|*=
-2 1 0|=
-1 0 0|
> 0 3 -|===


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 11.5912
P(chi-square) = 0.02066

Total sequences searched: 100

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: