Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

3 accessions found for Burkholderia sp. 383  

Data for CP000152  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000152.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000152_1648 CDS_1878617-1880728 70.3 1.5e-20 1
CP000152_0027 CDS_31057-29672 66.6 2e-19 1
CP000152_2708 CDS_3075160-3073316 58.7 4.1e-17 1
CP000152_2515 CDS_2867867-2869651 55.3 4.1e-16 1
CP000152_1607 CDS_1832915-1834372 38.9 2.9e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000152_1648 1/1 490 562 .. 1 70 [] 70.3 1.5e-20
CP000152_0027 1/1 253 323 .. 1 70 [] 66.6 2e-19
CP000152_2708 1/1 417 484 .. 1 70 [] 58.7 4.1e-17
CP000152_2515 1/1 380 447 .. 1 70 [] 55.3 4.1e-16
CP000152_1607 1/1 274 341 .. 1 70 [] 38.9 2.9e-11

Alignments of top-scoring domains:
CP000152_1648: domain 1 of 1, from 490 to 562: score 70.3, E = 1.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrllds..dkdpe.eareal
E +RIARELHD +gQ+L+a+k+ l++++++l+ ++++ p++ ++++l
CP000152_1 490 EKTRIARELHDDLGQQLTALKMDLSVVEQQLRVpgRTQPDeDVQTHL 536

deirelarealaevRrllgdLRpaal<-*
+ +r+l++ + a vRr++ dLRp l
CP000152_1 537 QGMRRLIDATVASVRRIAADLRPVML 562

CP000152_0027: domain 1 of 1, from 253 to 323: score 66.6, E = 2e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ERaR++RELHD+++Q++ ++kl+le a++++ ++ ++ +ea++al
CP000152_0 253 ERARLSRELHDGISQMMVSAKLMLESALARF--ERGTArlpEAEQAL 297

deirelarealaevRrllgdLRpaal<-*
+ + + ++l+evRr+ ++LRp+ l
CP000152_0 298 ASGVGRLGDTLREVRRISHALRPSML 323

CP000152_2708: domain 1 of 1, from 417 to 484: score 58.7, E = 4.1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ I RELHD +gQ L++++l+l+++++ ++ ++ ++ +d +
CP000152_2 417 ERQQIGRELHDDLGQKLTGASLMLSTLAQSR--RDGADDSQQVIDKV 461

relarealaevRrllgdLRpaal<-*
++++++++ +R l ++L p +
CP000152_2 462 SAIVEDGIETIRTLSRGLSPFDG 484

CP000152_2515: domain 1 of 1, from 380 to 447: score 55.3, E = 4.1e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RIARELHD+++Q+L+ +k le++ ++ + d++++++ ++++
CP000152_2 380 EQRRIARELHDELAQTLATLKNDLEWLIDRV--PQDDAQLARKIAAM 424

relarealaevRrllgdLRpaal<-*
++lar a a +Rr+++dLRp l
CP000152_2 425 HALARGAVAATRRIASDLRPLML 447

CP000152_1607: domain 1 of 1, from 274 to 341: score 38.9, E = 2.9e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD+ Q+ +++ l+l +++ + +++p + ++ ++
CP000152_1 274 ERTRIARDLHDTAKQRSFVLGLKLTELEYEA--QRHP-DLLPTVGAA 317

relarealaevRrllgdLR.paal<-*
r+la++ ++++ ++++++ pa+
CP000152_1 318 RRLADHLQQDLDNVVTGFSlPAIA 341


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 1 0|=
-13 16 0|==
-12 51 35|===*==
-11 118 290|============ *
-10 355 675|==================================== *
-9 562 766|========================================================= *
-8 506 590|=================================================== *
-7 428 371|=====================================*=====
-6 349 210|====================*==============
-5 342 112|===========*=======================
-4 164 58|=====*===========
-3 113 30|==*=========
-2 59 15|=*====
-1 40 7|*===
0 21 4|*==
1 14 2|*=
2 13 1|*=
3 7 0|=
4 6 0|=
5 0 0|
6 1 0|=
7 1 0|=
> 8 7 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1562.0636
P(chi-square) = 0

Total sequences searched: 3174

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: