Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for   

Data for CP000155  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000155.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000155_0405 CDS_426716-428056 67.9 1.7e-19 1
CP000155_3809 CDS_4153065-4154927 64.5 1.7e-18 1
CP000155_0810 CDS_835755-837221 40.0 2.8e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000155_0405 1/1 249 316 .. 1 70 [] 67.9 1.7e-19
CP000155_3809 1/1 408 478 .. 1 70 [] 64.5 1.7e-18
CP000155_0810 1/1 291 360 .. 1 70 [] 40.0 2.8e-11

Alignments of top-scoring domains:
CP000155_0405: domain 1 of 1, from 249 to 316: score 67.9, E = 1.7e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R +RELHD++ Q L ++k +e+++ ll ++ + +re l
CP000155_0 249 ERRRVSRELHDGINQLLVSVKYRIETVLGLL--QEGQQTLREPLLKG 293

relarealaevRrllgdLRpaal<-*
re++++a++e+Rr+ +dLRp++l
CP000155_0 294 RETLKQAIQEARRISHDLRPSIL 316

CP000155_3809: domain 1 of 1, from 408 to 478: score 64.5, E = 1.7e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpeearealde
ER+ IARELHDs++QsLs +k+q+ ++ r+l+s++ ++e+++ +e
CP000155_3 408 ERNVIARELHDSLAQSLSYLKIQVARLTRALQSkQVEDEQIDGITAE 454

irelarealaevRrllgdLRpaal<-*
++e + a++++R+ll+++R ++
CP000155_3 455 LKEGITSAYRQLRELLTTFRLSIS 478

CP000155_0810: domain 1 of 1, from 291 to 360: score 40.0, E = 2.8e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+ IA+E+HD +L aik+ ++ +++l+ ++ e+ +++
CP000155_0 291 ERKLIAQEIHDNFNATLVAIKMYSQKIEQLA--REGGEdaQIAGMGG 335

eirelarealaevRrllgdLRpaal<-*
i ++ +a++ +R l+++LRp +
CP000155_0 336 KITSIVTDAYSSARSLVSRLRPEII 360


Histogram of all scores:
score obs exp (one = represents 22 sequences)
----- --- ---
-15 5 0|=
-14 115 0|======
-13 238 0|===========
-12 284 75|===*=========
-11 365 621|================= *
-10 1058 1441|================================================= *
-9 1294 1636|==========================================================*
-8 940 1261|=========================================== *
-7 780 793|====================================*
-6 585 448|====================*======
-5 469 240|==========*===========
-4 254 125|=====*======
-3 128 64|==*===
-2 99 33|=*===
-1 64 16|*==
0 42 8|*=
1 27 4|*=
2 11 2|*
3 9 1|*
4 4 0|=
5 0 0|
6 2 0|=
> 7 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1780.5948
P(chi-square) = 0

Total sequences searched: 6782

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: