Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Erythrobacter litoralis HTCC2594  

Data for CP000157  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000157.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000157_2044 CDS_2077204-2075594 142.4 1.7e-48 1
CP000157_0835 CDS_861052-862113 106.3 3.6e-36 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000157_2044 1/1 341 423 .. 1 85 [] 142.4 1.7e-48
CP000157_0835 1/1 163 243 .. 1 85 [] 106.3 3.6e-36

Alignments of top-scoring domains:
CP000157_2044: domain 1 of 1, from 341 to 423: score 142.4, E = 1.7e-48
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+V Si++ T+R+++ l++f+++++gR++ALs++HdL
CP000157_2 341 ELNHRVKNTLANVLSIIALTRRRTDNLQDFADSLDGRIRALSATHDL 387

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+seW+ Lr+++eaeLaPy+++ ++ ++l+GPd
CP000157_2 388 --LTQSEWGTTPLRQVIEAELAPYASAKEDMLHLEGPD 423

CP000157_0835: domain 1 of 1, from 163 to 243: score 106.3, E = 3.6e-36
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+nHR KN LAvVQ +arQT++ + ++++v ++++R++ Ls++H++
CP000157_0 163 EMNHRAKNVLAVVQVLARQTAK--RNPEDYVSQLEARIAGLSASHNV 207

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++ +W + + eL++++L++++ ++Rit+sGP+
CP000157_0 208 --LVQNSWKDVPFDELIRSQLGHFEHMIGDRITVSGPP 243


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 12 0|==
-13 41 0|=====
-12 221 0|=======================
-11 276 24|==*=========================
-10 444 311|===============================*=============
-9 545 770|======================================================= *
-8 552 800|======================================================== *
-7 379 537|====================================== *
-6 206 293|===================== *
-5 149 145|==============*
-4 81 68|======*==
-3 39 31|===*
-2 28 14|=*=
-1 16 6|*=
0 8 3|*
1 2 1|*
2 2 0|=
3 1 0|=
4 0 0|
> 5 9 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2869.0242
P(chi-square) = 0

Total sequences searched: 3011

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: