Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for   

Data for CP000158  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000158.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000158_0425 CDS_427573-428574 90.5 1e-30 1
CP000158_3028 CDS_3262566-3261574 72.4 1.4e-24 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000158_0425 1/1 140 227 .. 1 85 [] 90.5 1e-30
CP000158_3028 1/1 136 218 .. 1 85 [] 72.4 1.4e-24

Alignments of top-scoring domains:
CP000158_0425: domain 1 of 1, from 140 to 227: score 90.5, E = 1e-30
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HRVKN+LA+ +++ T+R+a s ++++ +++ RL AL+raHdL
CP000158_0 140 EMSHRVKNLLAIASGLTSITSRSASSTEDMAKQLTNRLTALGRAHDL 186

V.pLtrseWagAdLreLleaeLaPygged..aeRitlsGPd<-*
V+pL + A L++Ll+ LaPy++ + ++Ri++s P+
CP000158_0 187 VrPLPGHAKTDALLGDLLSVLLAPYDDLGafSGRIRVSVPR 227

CP000158_3028: domain 1 of 1, from 136 to 218: score 72.4, E = 1.4e-24
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR +NtL++V S+a +na+s+++fve+F++RL A+sr +
CP000158_3 136 ELEHRLRNTLTMVGSLAILMGQNAESPQAFVETFTDRLDAMSRNLLM 182

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+++ +W+g + r+++eaeLa d++R+tl GPd
CP000158_3 183 --ISDNHWQGLTYRQIVEAELAQVLELDSPRLTLRGPD 218


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 10 0|=
-13 42 0|====
-12 249 0|=====================
-11 320 28|==*========================
-10 503 362|==============================*===========
-9 627 897|===================================================== *
-8 661 931|======================================================== *
-7 447 625|====================================== *
-6 254 341|====================== *
-5 163 169|==============*
-4 89 80|======*=
-3 63 37|===*==
-2 34 17|=*=
-1 16 7|*=
0 10 3|*
1 7 1|*
2 4 0|=
> 3 6 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 3295.3879
P(chi-square) = 0

Total sequences searched: 3505

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: