Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
41 projects found  

2 accessions found for   

Data for CP000159  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_1.hmm [HisKA]
Sequence database: CP000159.Gprot.fsa
per-sequence score cutoff: >= 26.8 [TC1]
per-domain score cutoff: >= 26.8 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA
Accession: PF00512.12
Description: His Kinase A (phosphoacceptor) domain
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000159_0470 CDS_658079-654039 100.9 2e-28 1
CP000159_0081 CDS_105156-107294 82.1 4.4e-23 1
CP000159_2427 CDS_3092293-3090968 81.2 7.9e-23 1
CP000159_2222 CDS_2830774-2834241 77.3 1e-21 1
CP000159_0321 CDS_447008-443673 75.8 2.7e-21 1
CP000159_0165 CDS_231996-233948 75.7 2.8e-21 1
CP000159_2452 CDS_3124140-3121873 75.7 2.8e-21 1
CP000159_1996 CDS_2536675-2533847 75.4 3.5e-21 1
CP000159_0090 CDS_124399-121196 74.2 7.4e-21 1
CP000159_0812 CDS_1061013-1063751 73.8 9.9e-21 1
CP000159_2013 CDS_2561318-2558088 73.0 1.7e-20 1
CP000159_2453 CDS_3124666-3126540 72.1 3e-20 1
CP000159_0560 CDS_757100-758404 71.6 4e-20 1
CP000159_2449 CDS_3115896-3118775 71.5 4.4e-20 1
CP000159_0811 CDS_1060094-1056663 71.0 6e-20 1
CP000159_0183 CDS_264255-260644 70.9 6.7e-20 1
CP000159_2334 CDS_2980688-2982430 69.9 1.2e-19 1
CP000159_2568 CDS_3258831-3254500 68.9 2.4e-19 1
CP000159_1599 CDS_2037910-2035196 68.7 2.8e-19 1
CP000159_2514 CDS_3198726-3196564 68.7 2.8e-19 1
CP000159_0457 CDS_636421-630413 68.6 2.9e-19 1
CP000159_0841 CDS_1108451-1107483 67.5 5.8e-19 2
CP000159_0849 CDS_1115735-1117741 66.8 9.6e-19 1
CP000159_0139 CDS_195674-200680 66.1 1.5e-18 1
CP000159_2265 CDS_2895026-2892573 64.2 5.1e-18 1
CP000159_0738 CDS_971923-974196 63.1 1.1e-17 1
CP000159_1207 CDS_1556762-1558552 62.8 1.3e-17 1
CP000159_1959 CDS_2484929-2488555 60.5 5.6e-17 1
CP000159_2764 CDS_3497168-3498673 57.2 4.9e-16 1
CP000159_0138 CDS_193235-195409 53.4 5.9e-15 1
CP000159_0082 CDS_109308-107353 49.2 9.1e-14 2
CP000159_0459 CDS_640398-638191 44.6 1.8e-12 1
CP000159_0070 CDS_84966-87374 42.5 7.3e-12 1
CP000159_2010 CDS_2554819-2552102 42.0 1e-11 1
CP000159_0341 CDS_477692-478780 40.0 3.6e-11 1
CP000159_1091 CDS_1413906-1412101 39.7 4.5e-11 1
CP000159_1781 CDS_2259784-2258546 35.8 5.8e-10 1
CP000159_0635 CDS_854074-858180 33.3 2.9e-09 1
CP000159_1173 CDS_1518042-1518299 29.8 3e-08 1
CP000159_0124 CDS_171483-170200 27.0 1.8e-07 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000159_0470 1/1 818 883 .. 1 87 [] 100.9 2e-28
CP000159_0081 1/1 470 537 .. 1 87 [] 82.1 4.4e-23
CP000159_2427 1/1 209 277 .. 1 87 [] 81.2 7.9e-23
CP000159_2222 1/1 922 990 .. 1 87 [] 77.3 1e-21
CP000159_0321 1/1 871 948 .. 1 87 [] 75.8 2.7e-21
CP000159_0165 1/1 416 480 .. 1 87 [] 75.7 2.8e-21
CP000159_2452 1/1 511 577 .. 1 87 [] 75.7 2.8e-21
CP000159_1996 1/1 706 773 .. 1 87 [] 75.4 3.5e-21
CP000159_0090 1/1 836 903 .. 1 87 [] 74.2 7.4e-21
CP000159_0812 1/1 686 755 .. 1 87 [] 73.8 9.9e-21
CP000159_2013 1/1 846 910 .. 1 87 [] 73.0 1.7e-20
CP000159_2453 1/1 367 438 .. 1 87 [] 72.1 3e-20
CP000159_0560 1/1 206 272 .. 1 87 [] 71.6 4e-20
CP000159_2449 1/1 724 794 .. 1 87 [] 71.5 4.4e-20
CP000159_0811 1/1 919 986 .. 1 87 [] 71.0 6e-20
CP000159_0183 1/1 949 1020 .. 1 87 [] 70.9 6.7e-20
CP000159_2334 1/1 422 490 .. 1 87 [] 69.9 1.2e-19
CP000159_2568 1/1 1207 1278 .. 1 87 [] 68.9 2.4e-19
CP000159_1599 1/1 674 745 .. 1 87 [] 68.7 2.8e-19
CP000159_2514 1/1 474 549 .. 1 87 [] 68.7 2.8e-19
CP000159_0457 1/1 1756 1831 .. 1 87 [] 68.6 2.9e-19
CP000159_0849 1/1 433 497 .. 1 87 [] 66.8 9.6e-19
CP000159_0139 1/1 1422 1501 .. 1 87 [] 66.1 1.5e-18
CP000159_0841 2/2 90 157 .. 1 87 [] 65.3 2.5e-18
CP000159_2265 1/1 274 342 .. 1 87 [] 64.2 5.1e-18
CP000159_0738 1/1 511 578 .. 1 87 [] 63.1 1.1e-17
CP000159_1207 1/1 349 424 .. 1 87 [] 62.8 1.3e-17
CP000159_1959 1/1 963 1037 .. 1 87 [] 60.5 5.6e-17
CP000159_2764 1/1 263 329 .. 1 87 [] 57.2 4.9e-16
CP000159_0138 1/1 496 561 .. 1 87 [] 53.4 5.9e-15
CP000159_0082 1/2 447 508 .. 1 87 [] 47.1 3.5e-13
CP000159_0459 1/1 531 594 .. 1 87 [] 44.6 1.8e-12
CP000159_0070 1/1 236 304 .. 1 87 [] 42.5 7.3e-12
CP000159_2010 1/1 525 592 .. 1 87 [] 42.0 1e-11
CP000159_0341 1/1 281 306 .. 1 26 [. 40.0 3.6e-11
CP000159_1091 1/1 237 306 .. 1 87 [] 39.7 4.5e-11
CP000159_1781 1/1 194 257 .. 1 87 [] 35.8 5.8e-10
CP000159_0635 1/1 1135 1211 .. 1 87 [] 33.3 2.9e-09
CP000159_1173 1/1 12 78 .. 1 87 [] 29.8 3e-08
CP000159_0124 1/1 179 272 .. 1 87 [] 27.0 1.8e-07

Alignments of top-scoring domains:
CP000159_0470: domain 1 of 1, from 818 to 883: score 100.9, E = 2e-28
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+flan+sHE+RTP+++++g+a+lL + t+l++eq
CP000159_0 818 AKSKFLANMSHEIRTPMNGVIGFADLLSD---------TDLTPEQ-- 853

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++++ i++++ ll++i+d+L +s++eag
CP000159_0 854 ----------QQFVDAIQSSGTTLLSIIDDILNFSKLEAG 883

CP000159_0081: domain 1 of 1, from 470 to 537: score 82.1, E = 4.4e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks flan+sHE+RTPLt+I+g+ae+L +e+ ++ + +
CP000159_0 470 LKSAFLANMSHEIRTPLTSIIGFAEALGDEV-------GDGNGNT-- 507

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ i+r+++rll+ ++ +L ls++eag
CP000159_0 508 ----------GRFAGLIERSGRRLLDTLDGVLNLSKLEAG 537

CP000159_2427: domain 1 of 1, from 209 to 277: score 81.2, E = 7.9e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++e++an+sH+LR P+++I+gy+e+ + +d++l++++r
CP000159_2 209 MRRELVANVSHDLRSPIASIQGYLETVHM-------KDGDLPPQER- 247

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++y++t+lr ++rl+ L+n+l +ls++e+
CP000159_2 248 ----------QRYVKTALRNTKRLNTLVNELFELSKLETK 277

CP000159_2222: domain 1 of 1, from 922 to 990: score 77.3, E = 1e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ks flan+sHE+RTPLt+I+g+ae++ +el ++ ++ +
CP000159_2 922 MKSVFLANMSHEIRTPLTSIIGFAEAIGDEL-------GDETAGPV- 960

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + i+++++rll+ ++ +L ls++eag
CP000159_2 961 ----------LRFAQLIEKSGNRLLETLDGVLNLSKLEAG 990

CP000159_0321: domain 1 of 1, from 871 to 948: score 75.8, E = 2.7e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ks flan+sHE+RTPLt+I+g+ae++ +e+ ++ ++ s++++
CP000159_0 871 MKSAFLANMSHEIRTPLTSIIGFAEVIGDEAT--SLLEHSDSPPDAV 915

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++L ++ + i+++++rll+ ++ +L lsr+eag
CP000159_0 916 TAL-------DQFADLIEESGHRLLETLDTVLNLSRLEAG 948

CP000159_0165: domain 1 of 1, from 416 to 480: score 75.7, E = 2.8e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks +lan+sHE+RTPLt+I g++e+L+ +ls ++
CP000159_0 416 LKSAMLANMSHEIRTPLTSITGFSEVLEQ----------NLSGQH-- 450

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ +i++++erl+r ++ +L ls++e+
CP000159_0 451 ----------GDFATKIRKSSERLQRTLESVLHLSKLESS 480

CP000159_2452: domain 1 of 1, from 511 to 577: score 75.7, E = 2.8e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ks +lan+sHE+RTPLt+I+g+ae++ + + ++ +
CP000159_2 511 MKSAMLANMSHEIRTPLTGIIGFAEAIGD---------EIDGDGGV- 547

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + + i+++++rll+ ++ +L ls++eag
CP000159_2 548 ----------AHFADLIEDSGRRLLDTLDAVLNLSKLEAG 577

CP000159_1996: domain 1 of 1, from 706 to 773: score 75.4, E = 3.5e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks lan+sHELRTPLt+I+g+ae++ +e+ ++ +
CP000159_1 706 LKSAVLANMSHELRTPLTSILGFAEAIDDEA-------SDGAGPV-- 743

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + i +++erllr +++L lsr+ea+
CP000159_1 744 ----------SRFASLIAKSGERLLRTFDNILNLSRLEAE 773

CP000159_0090: domain 1 of 1, from 836 to 903: score 74.2, E = 7.4e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ks flan+sHE+RTPLt+I+g+ae++ +e+ + ++
CP000159_0 836 MKSAFLANMSHEIRTPLTSIIGFAEAIGDEV-------SGGDPTV-- 873

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ i++ ++rll+ ++ +L ls++ea+
CP000159_0 874 ----------SRFAGLIEKGGRRLLETLDAVLNLSKLEAE 903

CP000159_0812: domain 1 of 1, from 686 to 755: score 73.8, E = 9.9e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks +lan+sHE RTPL +++g a+lL+e+l+ ++ l e
CP000159_0 686 LKSAMLANMSHEVRTPLMSMIGSADLLREDLE-----EAGLEGEP-- 725

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ e i r+++rl++ ++ +L+lsr+e+g
CP000159_0 726 ----------ADMAEQIFRSGQRLRETLDSVLELSRLESG 755

CP000159_2013: domain 1 of 1, from 846 to 910: score 73.0, E = 1.7e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++fla+ sHELRTPLt I+g +e+L+ + e+
CP000159_2 846 LKEDFLATTSHELRTPLTNILGSLEVLRG----------MMEGEE-- 880

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+l+ i++ ++rl r +n lLdls +++g
CP000159_2 881 ----------TEFLDMIEENGKRLKRTLNALLDLSMLRSG 910

CP000159_2453: domain 1 of 1, from 367 to 438: score 72.1, E = 3e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks +lan+ HE+RTPLtaI+g+ae++ + +a++ +l+e + l
CP000159_2 367 LKSALLANMNHEIRTPLTAIIGFAEAIGT-----TASEMDLPEHTPL 408

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y + i+++++rll+ +d+Ldls++eag
CP000159_2 409 ----------TGYADLIEQSGKRLLDTFEDILDLSQLEAG 438

CP000159_0560: domain 1 of 1, from 206 to 272: score 71.6, E = 4e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+sef+ n+sHE R+P+ +I+gy+e+L + + l++eqr
CP000159_0 206 LQSEFIGNVSHEVRNPIFSISGYLEALGT---------PGLDDEQR- 242

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ y e++l ++rl++L ndl d++r+e
CP000159_0 243 ----------KMYSEKALTNLNRLQNLFNDLIDIARLEYK 272

CP000159_2449: domain 1 of 1, from 724 to 794: score 71.5, E = 4.4e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks flan+sHE+RTPLt+I+g+ael+ e+ g +ls+ +
CP000159_2 724 LKSAFLANISHEIRTPLTSIIGFAELIGSEA-----GALDLSDSPL- 764

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y i+r+++rll+ ++ +L ls++++g
CP000159_2 765 ----------PGYATMIERSGKRLLETLEGVLNLSKLQSG 794

CP000159_0811: domain 1 of 1, from 919 to 986: score 71.0, E = 6e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks +lan+sHE+RTPLt+I+g+a+++ e +++++e ++
CP000159_0 919 AKSAMLANMSHEIRTPLTSIIGFADAIGE---------ETQDAEGAA 956

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + i ++++rll+ ++ +L ls++eag
CP000159_0 957 ----------LRFANLIGKSGRRLLNTLDGVLNLSKLEAG 986

CP000159_0183: domain 1 of 1, from 949 to 1020: score 70.9, E = 6.7e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks +lan+sHE+RTPLt+I+g+ae+L +e+ + elsee l
CP000159_0 949 LKSALLANMSHEIRTPLTSIIGFAEMLGREA-----SGLELSEESPL 990

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y +ti+++++rll+ +n +L ls+++ag
CP000159_0 991 ----------PGYASTIEQSGKRLLETLNGVLNLSKLQAG 1020

CP000159_2334: domain 1 of 1, from 422 to 490: score 69.9, E = 1.2e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks flan+sHE+RTPLt+I+g+ae++ + + +++ e +
CP000159_2 422 LKSVFLANMSHEIRTPLTSIIGFAETIGDAA-------GDAAGENV- 460

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + i+++++rll+ +n +L ls++e+g
CP000159_2 461 ----------VRFARLIKNSGHRLLNTLNAVLNLSKLETG 490

CP000159_2568: domain 1 of 1, from 1207 to 1278: score 68.9, E = 2.4e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks flan+sHE+RTPLt+I+g+ae+L +e+ ++l++ +
CP000159_2 1207 LKSAFLANMSHEIRTPLTSIIGFAEVLGAEV-------GALDASA-A 1245

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ L ++ + i++ ++rll+ ++ +L ls++eag
CP000159_2 1246 GSL-------EQKAHLIEQGGKRLLDTLEGVLNLSKLEAG 1278

CP000159_1599: domain 1 of 1, from 674 to 745: score 68.7, E = 2.8e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks +lan+sHE+RTPLt+I+g+ae+ +e+ ++ +l+++ l
CP000159_1 674 LKSSLLANMSHEIRTPLTSIIGFAEATNAEA-----KELDLPDDSPL 715

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y e i+++++rll+ ++ +L ls++eag
CP000159_1 716 ----------PNYAELIEQSGRRLLETLEGVLNLSKLEAG 745

CP000159_2514: domain 1 of 1, from 474 to 549: score 68.7, E = 2.8e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
ks +lan+sHE+RTPLt+I+g++e+++ee+d + a +++++ ++
CP000159_2 474 LKSTMLANMSHEIRTPLTSIIGFSETIEEEAD-LlEATPADANPSTL 519

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + i + ++rll+ ++ +L lsr+eag
CP000159_2 520 -----------SRFAHLIGKNGRRLLDTLDGVLNLSRLEAG 549

CP000159_0457: domain 1 of 1, from 1756 to 1831: score 68.6, E = 2.9e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ks +lan+sHE+RTPLt+I+g+ae+++ee + l ++ +
CP000159_0 1756 MKSSLLANMSHEIRTPLTSILGFAEMIEEEI-------GSLEPPAEA 1795

peLR.ledpeyreyletilreaerllrLindlLdlsrieag<-*
+ L +l e+ i+++++rl + + +L lsr+eag
CP000159_0 1796 GDLKpL-----GEFAGLIQKSGQRLMDTLTGVLNLSRLEAG 1831

CP000159_0849: domain 1 of 1, from 433 to 497: score 66.8, E = 9.6e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks ++ n+sHELRTP+t+I gyae++ e e+ e++
CP000159_0 433 LKSTLIHNMSHELRTPITTITGYAEVIME----------EAEEPH-- 467

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r + i+++++rl++ ++ +Ld+++ie+g
CP000159_0 468 ----------RSFALQIRESGRRLSDTLQSVLDMAQIESG 497

CP000159_0139: domain 1 of 1, from 1422 to 1501: score 66.1, E = 1.5e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks flan+sHE+RTPLt+I+g+ae++ e + +++q+
CP000159_0 1422 AKSVFLANMSHEIRTPLTSILGFAEAIGE---------EVGGDDQTE 1459

peLR..ledpeyreyletilreaerllrLindlLdlsrieag<-*
+ R++ p r++ i++++erl + + +L ls++eag
CP000159_0 1460 KTDRsdVDLPALRQFAALIESSGERLMNTLTGVLNLSKLEAG 1501

CP000159_0841: domain 2 of 2, from 90 to 157: score 65.3, E = 2.5e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ef+ n+sHEL+TP+ +++g+ae+Ll+ ++l++e +
CP000159_0 90 YRREFIGNVSHELKTPIFSVQGFAETLLD---------GALDDESVN 127

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +l++il+ a+rl++L +dl ++++ie+
CP000159_0 128 ----------RTFLKKILHHANRLDSLARDLSTITKIETD 157

CP000159_2265: domain 1 of 1, from 274 to 342: score 64.2, E = 5.1e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+f+a+lsHE+RTPLt I+g + +l ++ +e + +
CP000159_2 274 AKSRFFADLSHEFRTPLTLILGPLRQALGKQG------DEIPGPL-- 312

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re l ++r+a+r+ rL+++l dl+r ++g
CP000159_2 313 ----------RERLGQADRQARRMARLVDQLYDLARFDEG 342

CP000159_0738: domain 1 of 1, from 511 to 578: score 63.1, E = 1.1e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ks +lan sHE+RTPLt+I+g+ae + + +e ++ +
CP000159_0 511 MKSALLANTSHEFRTPLTSIIGFAEEIAT--------MAEDDDAPI- 548

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + i+++++rll ++ +L lsr++ g
CP000159_0 549 ----------GRFADHIENSGRRLLGTLDAILNLSRLQGG 578

CP000159_1207: domain 1 of 1, from 349 to 424: score 62.8, E = 1.3e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks flan+sHE+RTPLt+I+g+a+++ ee ++ ++++e ++
CP000159_1 349 AKSAFLANMSHEIRTPLTSIIGFADAIGEEI----QSLKDCPDEANI 391

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
L ++ e + + ++rll+ ++ +L ls++e+g
CP000159_1 392 VQL-------DRFSELVGQGGKRLLDTLDAVLNLSKLESG 424

CP000159_1959: domain 1 of 1, from 963 to 1037: score 60.5, E = 5.6e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
ks flan+sHE+RTPLt+I+g+ae++ e+ ++ + +e + +
CP000159_1 963 LKSAFLANISHEIRTPLTSILGFAEAIGGEV--EgARRVEEVDHASL 1007

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ + i+++++rl + + +L ls+++ag
CP000159_1 1008 -----------ARFSSLIEQSGQRLMDTLTGVLNLSKLQAG 1037

CP000159_2764: domain 1 of 1, from 263 to 329: score 57.2, E = 4.9e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ f+an++HEL TPLta++g++el+l+ e+++e
CP000159_2 263 ALRGFTANAAHELQTPLTALQGHVELALR---------RERTPES-- 298

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yre l+ ++r + l r ++ lL+l+r++ +
CP000159_2 299 ---------YRETLRLLDRKLGGLVRTLRALLTLTRLDRE 329

CP000159_0138: domain 1 of 1, from 496 to 561: score 53.4, E = 5.9e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f+ ++H+LR+PL++ g + l++e + ++e++
CP000159_0 496 RLDSFAGLVAHDLRNPLNVATGRLRLARE---------ERAPEKT-- 531

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r l ++r++ r++++i+d+L+l++ ++
CP000159_0 532 ----------RSHLAAVDRSLGRMDEIIEDVLTLTWGGQD 561

CP000159_0082: domain 1 of 2, from 447 to 508: score 47.1, E = 3.5e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f+ ++H+LR+PL++ +g +el ++ e+
CP000159_0 447 RLDNFAGLVAHDLRNPLNVAKGRLELVED-------------TED-- 478

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l+ i+r++ r++++i+dlL +++ ++
CP000159_0 479 ----------LSHLSAIDRALARMDEIIEDLLAITWGGQK 508

CP000159_0459: domain 1 of 1, from 531 to 594: score 44.6, E = 1.8e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ef+ ++H+LR+PL++ ++ + l e d++ e +
CP000159_0 531 RLDEFAGIVAHDLRNPLNVAQMRTTLSVE--------DPDYEELH-- 567

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++++++r++++i+d L l+r +++
CP000159_0 568 -------------RRKVHEALDRMEDIISDTLVLARRGNE 594

CP000159_0070: domain 1 of 1, from 236 to 304: score 42.5, E = 7.3e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fl +sH +R PLt +g +++Lle ++ ++l++e
CP000159_0 236 AKSQFLEEISHAFRRPLTLTLGPIDTLLE------GRHGALGDEV-- 274

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r l+ ++r + rll L+n+lLdl+ +e+g
CP000159_0 275 ----------RTQLRLAERNGTRLLWLVNQLLDLAELETG 304

CP000159_2010: domain 1 of 1, from 525 to 592: score 42.0, E = 1e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++++ +++H+L + L I + +++L++++ ++ +++
CP000159_2 525 SLGRLVGGIAHDLGNLLVPITLGVKVLKRRV-------DDTDDKV-- 562

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l+ i+++aer +++++++L ++r +g
CP000159_2 563 ----------DQTLSMIQKSAERGSDMVEQVLAFARGVEG 592

CP000159_0341: domain 1 of 1, from 281 to 306: score 40.0, E = 3.6e-11
*->akseflanlsHELRTPLtaIrgyael<-*
+ks +lan+sHE+RTPLt+I+g+ae+
CP000159_0 281 MKSALLANMSHEIRTPLTSIIGFAEV 306

CP000159_1091: domain 1 of 1, from 237 to 306: score 39.7, E = 4.5e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++++ +++H+L++ L++++g++elL+++++ ++ l++
CP000159_1 237 TLGRMTMGVAHDLNNLLSGLIGHIELLKDQVE-----RASLTDSI-- 276

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +eti+ ae +Li+ l + r +++
CP000159_1 277 ----------RPSIETIETTAEDGAALIEKLQRYIRHDTQ 306

CP000159_1781: domain 1 of 1, from 194 to 257: score 35.8, E = 5.8e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ ++H+L TPL++++g +++L++ ++l +++r
CP000159_1 194 LWMGMAREAAHQLGTPLSSLMGWIQMLRT---------PDLAADKR- 230

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l i++++erl+r +++ s i+++
CP000159_1 231 ----------ERALTEIENDVERLQRVADRF---SDIGSQ 257

CP000159_0635: domain 1 of 1, from 1135 to 1211: score 33.3, E = 2.9e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +e+++ ++HE+++PLt +++ ++ L++ a + ++ +++
CP000159_0 1135 AWREMARQVAHEIKNPLTPMKLSIQHLRR------AFTRTDDATDAA 1175

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + ++++t+ +++e+l r+ +++ +++r+ +
CP000159_0 1176 ----EFAEVFDRITSTLVEQVESLVRIADEFSTFARLPTR 1211

CP000159_1173: domain 1 of 1, from 12 to 78: score 29.8, E = 3e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ e l+++ H+L++PL+ I+g+a+ Lle l +++el+++
CP000159_1 12 ELHEALSTVYHDLNNPLSIISGNAQFLLE-----LSREEELDDQF-- 51

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + i+++++r+ + +++l +r++
CP000159_1 52 ----------ASSAQDIQEASQRMAESLQRL---TRLRDA 78

CP000159_0124: domain 1 of 1, from 179 to 272: score 27.0, E = 1.8e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldk..............
+ ++f+ + H+LR+PL+a +++++++++ +++++ + +++
CP000159_0 179 RTEQFAELVTHDLRNPLNAAQMNLHMAQR---Llgdegslagaspga 222

.......v.lagdtelseeqrlpeLRledpeyreyletilreaerllrLi
++++ ++ +++ + +se+ ++ l++ +r+++r++ +i
CP000159_0 223 ggeeageDgAGAEKSASEKL------------QRHLRISRRALDRMEGII 260

ndlLdlsrieag<-*
d L l+ ++
CP000159_0 261 TDTLALAHGAQN 272


Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-14 7 0|=
-13 25 2|*==
-12 113 64|=======*=====
-11 238 332|=========================== *
-10 439 615|================================================= *
-9 493 636|======================================================= *
-8 501 476|====================================================*===
-7 387 300|=================================*=========
-6 222 172|===================*=====
-5 143 94|==========*=====
-4 73 50|=====*===
-3 39 26|==*==
-2 34 14|=*==
-1 18 7|*=
0 9 3|*
1 10 1|*=
2 1 1|*
3 4 0|=
4 1 0|=
5 1 0|=
6 0 0|
7 1 0|=
8 0 0|
> 9 42 -|=====


% Statistical details of theoretical EVD fit:
mu = -8.9758
lambda = 0.6525
chi-sq statistic = 271.3053
P(chi-square) = 0

Total sequences searched: 2801

Whole sequence top hits:
tophits_s report:
Total hits: 40
Satisfying E cutoff: 40
Total memory: 22K

Domain top hits:
tophits_s report:
Total hits: 40
Satisfying E cutoff: 40
Total memory: 37K


Acknowledgements:

This research is funded by:

Developed by: