Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Rhodospirillum rubrum ATCC 11170  

Data for CP000230  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000230.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000230_3278 CDS_3783855-3785843 98.0 9.7e-28 2
CP000230_0663 CDS_788237-787203 94.7 8.7e-27 1
CP000230_2744 CDS_3186001-3184877 77.0 9.2e-22 1
CP000230_0692 CDS_822938-821736 61.6 2.3e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000230_3278 1/2 425 511 .. 1 94 [] 97.2 1.7e-27
CP000230_0663 1/1 153 241 .. 1 94 [] 94.7 8.7e-27
CP000230_2744 1/1 172 258 .. 1 94 [] 77.0 9.2e-22
CP000230_0692 1/1 204 290 .. 1 94 [] 61.6 2.3e-17

Alignments of top-scoring domains:
CP000230_3278: domain 1 of 2, from 425 to 511: score 97.2, E = 1.7e-27
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ++SSLL+LQ r + + aL+ +q R+ +
CP000230_3 425 EIHHRVKNNLQIVSSLLSLQHRALPPGPA-----RSALMQAQTRINA 466

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
A++H+ LY++ed + vd++ +l++L + + +g+ ++ ++L+ +
CP000230_3 467 LATVHRSLYETEDPSLVDLGRFLRELGQLIYDGMGGLNGIVDLD--I 511

CP000230_0663: domain 1 of 1, from 153 to 241: score 94.7, E = 8.7e-27
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+L+++++L+r+Q + ++d+++ ++aL+E+ +R+ +
CP000230_0 153 EVNHRVANSLALVAALVRMQGQVVEDPKA-----RAALEETWGRIVA 194

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+ iH++LY+sed+ v ++eYl+ L++++ ++++ + ++ +++D+
CP000230_0 195 VGGIHRRLYTSEDVRFVGIDEYLKSLVADIESAMTSARCHHTIRVDT 241

CP000230_2744: domain 1 of 1, from 172 to 258: score 77.0, E = 9.2e-22
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRV N+LQ+I+S+L++ ar +++ee+ + +L+++++R+lS
CP000230_2 172 EMRHRVGNSLQLIASILMMKARAVSSEEA-----RHHLQDAHQRILS 213

mAliHEeLYkse.dldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
+A +++L s+++ + + +++Yl +L+e L + +++ i +k +
CP000230_2 214 IAAAQQQLQASRpG-EAIALAPYLGRLCETLTATLIGDARPIVVK--V 258

*

CP000230_2 - -

CP000230_0692: domain 1 of 1, from 204 to 290: score 61.6, E = 2.3e-17
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRVKNNLQ++ ++L+ Q + d+ ++ L +RV +
CP000230_0 204 ELQHRVKNNLQLVYAMLSKQLGDTVDPFE-----RKGLSAIARRVFT 245

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
A+++++L e + t df++Yl+ L+++L + g +d isL +
CP000230_0 246 LAQVYDHLLGREMTRTTDFGSYLKSLCASLADIQGSANDEISLT--C 290


Histogram of all scores:
score obs exp (one = represents 18 sequences)
----- --- ---
-15 3 0|=
-14 11 0|=
-13 42 23|=*=
-12 196 249|=========== *
-11 1061 693|======================================*====================
-10 857 897|================================================ *
-9 593 757|================================= *
-8 463 508|========================== *
-7 208 301|============ *
-6 185 168|=========*=
-5 68 90|====*
-4 51 47|==*
-3 23 25|=*
-2 11 13|*
-1 6 6|*
0 4 3|*
1 1 1|*
2 1 0|=
3 1 0|=
4 0 0|
5 1 0|=
6 0 0|
7 0 0|
> 8 5 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 299.3629
P(chi-square) = 0

Total sequences searched: 3791

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: