Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Rhodospirillum rubrum ATCC 11170  

Data for CP000230  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000230.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000230_0740 CDS_867311-865815 113.6 1.5e-38 1
CP000230_2539 CDS_2957617-2959086 105.8 6.7e-36 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000230_0740 1/1 298 380 .. 1 85 [] 113.6 1.5e-38
CP000230_2539 1/1 300 382 .. 1 85 [] 105.8 6.7e-36

Alignments of top-scoring domains:
CP000230_0740: domain 1 of 1, from 298 to 380: score 113.6, E = 1.5e-38
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR+KN+LAvVQ+iarQ++ n ++++ f e+F +RLqAL+++Hd+
CP000230_0 298 ELTHRSKNLLAVVQGIARQSAANVPDVKTFTERFGARLQALGESHDI 344

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ ++W+gA + +L++a L+++ + eR+tl GPd
CP000230_0 345 --LVSTDWRGAAIPDLARAHLGHFLAVSKERLTLRGPD 380

CP000230_2539: domain 1 of 1, from 300 to 382: score 105.8, E = 6.7e-36
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+NtLA+V Si + Tl n+++l+ f++aF++R++ L+++H+L
CP000230_2 300 ELDHRVRNTLALVLSISNRTLSNEDTLQGFHQAFTQRIHGLAATHSL 346

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L W +L+++++aeLaPy d++R++l+G +
CP000230_2 347 --LAKQGWTKLSLHDIVRAELAPYVETDGTRLRLEGGE 382


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 5 0|=
-13 35 0|===
-12 206 0|================
-11 275 30|==*===================
-10 522 392|==============================*==========
-9 690 970|====================================================== *
-8 718 1007|======================================================== *
-7 482 676|====================================== *
-6 339 369|=========================== *
-5 206 183|==============*=
-4 130 86|======*===
-3 76 40|===*==
-2 45 18|=*==
-1 29 8|*==
0 9 3|*
1 9 1|*
2 4 0|=
3 4 0|=
4 0 0|
5 1 0|=
6 1 0|=
7 0 0|
8 0 0|
9 1 0|=
> 10 4 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2331.1748
P(chi-square) = 0

Total sequences searched: 3791

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: