Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for   

Data for CP000248  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000248.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000248_0486 CDS_528858-530525 138.4 4.6e-47 1
CP000248_1390 CDS_1439353-1440267 118.4 2.8e-40 1
CP000248_2653 CDS_2904622-2905962 82.8 4e-28 1
CP000248_0572 CDS_623030-621723 65.0 4.5e-22 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000248_0486 1/1 357 439 .. 1 85 [] 138.4 4.6e-47
CP000248_1390 1/1 116 197 .. 1 85 [] 118.4 2.8e-40
CP000248_2653 1/1 258 337 .. 1 85 [] 82.8 4e-28
CP000248_0572 1/1 246 328 .. 1 85 [] 65.0 4.5e-22

Alignments of top-scoring domains:
CP000248_0486: domain 1 of 1, from 357 to 439: score 138.4, E = 4.6e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+V Si+ T+R+a+sl+ef+++++gR++ALs++HdL
CP000248_0 357 ELNHRVKNTLANVLSIISLTRRRATSLPEFADSLEGRIRALSATHDL 403

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+s+W+ + +++aeLaPy+g+ ++ +++ GP+
CP000248_0 404 --LTQSDWGTTPIELVIRAELAPYAGDTQRHVEMGGPE 439

CP000248_1390: domain 1 of 1, from 116 to 197: score 118.4, E = 2.8e-40
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtL vVQ++a QT+R+a+ +++ v++F +RL+ALs+aHd
CP000248_1 116 ELNHRVKNTLMVVQAMAYQTFRGAGLPEQPVASFNQRLAALSGAHDA 162

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+r++W+g L++++++ L +g+ ++Ri +sGPd
CP000248_1 163 --LSRANWSGTALADIVREGLLICGDS-DPRISVSGPD 197

CP000248_2653: domain 1 of 1, from 258 to 337: score 82.8, E = 4e-28
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+nHR+KN+L+vVQ++ar + + +ef+++F+ RL++Ls+ +dL
CP000248_2 258 EVNHRSKNLLSVVQALARRS---GGGDPEFLRRFENRLASLSANQDL 301

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+r+ W+ ++ eL+ a+La g + +e++ +G +
CP000248_2 302 --LVRRGWSTIMMDELADAQLAILGRDSREQVLTQGLS 337

CP000248_0572: domain 1 of 1, from 246 to 328: score 65.0, E = 4.5e-22
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN++Av+ +i+ +++R+ a + +v++++ R++AL aH +
CP000248_0 246 ELNHRVKNLFAVILAIVKMSARGDAAAAPAVDRIAKRIHALVTAHEV 292

VpLtrseW..agAdLreLleaeLaPyggedaeRitlsGPd<-*
t+ ++++ +d+++L+ ++aPy++ +eR +l G++
CP000248_0 293 ---TQGTGkdQTVDFADLVGKAIAPYRSS-SERCELAGEE 328


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 7 0|=
-13 25 0|===
-12 210 0|====================
-11 294 27|==*========================
-10 478 343|===============================*============
-9 601 850|======================================================= *
-8 616 883|======================================================== *
-7 438 593|======================================== *
-6 270 323|========================= *
-5 167 160|==============*=
-4 96 76|======*==
-3 49 35|===*=
-2 28 16|=*=
-1 18 7|*=
0 8 3|*
1 6 1|*
2 3 0|=
3 1 0|=
4 2 0|=
5 0 0|
> 6 7 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2911.6208
P(chi-square) = 0

Total sequences searched: 3324

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: