Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Rhodopseudomonas palustris HaA2  

Data for CP000250  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000250.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000250_3013 CDS_3445749-3446834 110.4 3.7e-31 1
CP000250_0497 CDS_557018-555756 94.2 1.5e-26 1
CP000250_2936 CDS_3358389-3357340 85.7 3.8e-24 1
CP000250_2432 CDS_2794889-2795989 61.4 3.1e-17 1
CP000250_4106 CDS_4699140-4698103 57.5 4.2e-16 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000250_3013 1/1 161 248 .. 1 94 [] 110.4 3.7e-31
CP000250_0497 1/1 228 303 .. 1 81 [. 94.2 1.5e-26
CP000250_2936 1/1 148 231 .. 1 94 [] 85.7 3.8e-24
CP000250_2432 1/1 167 253 .. 1 94 [] 61.4 3.1e-17
CP000250_4106 1/1 154 241 .. 1 94 [] 57.5 4.2e-16

Alignments of top-scoring domains:
CP000250_3013: domain 1 of 1, from 161 to 248: score 110.4, E = 3.7e-31
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+LQ+I+SLL LQa ++k+ ev ++aL + +RV++
CP000250_3 161 EVNHRVGNSLQIIASLLHLQASSSKESEV-----KAALTNAMGRVAA 202

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++LY+s dl++v + +Yle L+e+L++s+++ + L lD
CP000250_3 203 VAQVHRRLYTSHDLKSVMLNQYLEALLEDLRRSAEGNRMSR-LTLDA 248

CP000250_0497: domain 1 of 1, from 228 to 303: score 94.2, E = 1.5e-26
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+L + +LLr Qar +++ +v ++aL+ + RV+S
CP000250_0 228 EMSHRVKNSLTSVVGLLRVQARGSESADV-----KNALENAAMRVAS 269

mAliHEeLYksedldtvdfseYlekLtenLfqsy<-*
+A +H++L+++ ++ vd+s+++ L++nL +s+
CP000250_0 270 IAEVHDHLWRGSKVGFVDLSDFVGHLCKNLQSSA 303

CP000250_2936: domain 1 of 1, from 148 to 231: score 85.7, E = 3.8e-24
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+LQ+I+S L+ ar++++ee+ + Lr ++nRV+S
CP000250_2 148 EVQHRVANSLQIIASVLMQSARRVQSEEA-----RGQLRNAHNRVMS 189

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A ++++L++ + +tv+++ Y+ L +L s+ ++ d++s +
CP000250_2 190 IAALQRQLSTASG-ETVELRTYFIQLSQSLGASMIDDPDRLS----I 231

CP000250_2432: domain 1 of 1, from 167 to 253: score 61.4, E = 3.1e-17
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRVKNNLQ++++L+rL+ar++ + e+ aL +R+ +
CP000250_2 167 ELQHRVKNNLQLVTALVRLEARSAAEGET------VALTRLASRIDA 207

mAliHEeLYkse..dldtvdfseYlekLtenLfqsygvgsdgisLklDl<
+++ L+ + +++d+++Yl+ +te +q++g +++ +L+ +
CP000250_2 208 LTALYRILSAESaaG-SDIDLGQYLSDVTEAVMQAHGSEGIAYDLN--V 253

-*

CP000250_2 - -

CP000250_4106: domain 1 of 1, from 154 to 241: score 57.5, E = 4.2e-16
*->EIHHRVKNNLQvISSLLrLQarkf.kdeevikdEVleaLrEsqnRVl
E +HRV NN+Q +S++LrL a ++++d+++ l aL +++ R
CP000250_4 154 ELQHRVANNMQFVSAMLRLYAKRAgQDPAA----MLTALDDARVRLD 196

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
+m+ +H++LY ++ + ++e++++L++nL +++g ++ + s++ +
CP000250_4 197 TMSRLHRHLYDPVNVTR-PVGEFFQELCANLAEAAGAKDVRFSID--M 241

*

CP000250_4 - -


Histogram of all scores:
score obs exp (one = represents 21 sequences)
----- --- ---
-15 5 0|=
-14 24 0|==
-13 84 29|=*==
-12 277 307|==============*
-11 1207 856|========================================*=================
-10 1083 1108|====================================================*
-9 789 936|====================================== *
-8 542 628|========================== *
-7 257 372|============= *
-6 221 207|=========*=
-5 83 111|==== *
-4 51 59|==*
-3 27 31|=*
-2 12 16|*
-1 13 8|*
0 0 4|*
1 0 2|*
> 2 8 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 333.5682
P(chi-square) = 0

Total sequences searched: 4683

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: