Crenarchaeota Euryarchaeota Nanoarchaeota
Other Archaea
Classification of phyla is from NCBI page
Search:
54 projects found  

1 accessions found for Methanospirillum hungatei JF-1  

Data for CP000254  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000254.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000254_2601 CDS_2958838-2958191 160.0 2e-45 1
CP000254_1665 CDS_1942841-1945135 122.5 8.9e-35 2
CP000254_2944 CDS_3308080-3310716 116.6 4.3e-33 1
CP000254_2552 CDS_2907351-2910506 115.4 9.2e-33 1
CP000254_0435 CDS_525786-527759 106.6 3e-30 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000254_2601 1/1 24 110 .. 1 94 [] 160.0 2e-45
CP000254_1665 2/2 564 650 .. 1 94 [] 119.5 6.2e-34
CP000254_2944 1/1 681 749 .. 1 74 [. 116.6 4.3e-33
CP000254_2552 1/1 844 930 .. 1 94 [] 115.4 9.2e-33
CP000254_0435 1/1 451 534 .. 1 94 [] 106.6 3e-30

Alignments of top-scoring domains:
CP000254_2601: domain 1 of 1, from 24 to 110: score 160.0, E = 2e-45
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNN+Qv+SSLL +Qar+++ +ev +++L EsqnR++S
CP000254_2 24 EIHHRVKNNMQVVSSLLFMQARSTQQPEV-----RDILLESQNRIRS 65

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE+LY+sed++++d ++Ylek+++++f+sy+ + + i Lk +
CP000254_2 66 IALVHEKLYQSEDFKRIDYKDYLEKIAHHIFESYQISPGTILLK--V 110

CP000254_1665: domain 2 of 2, from 564 to 650: score 119.5, E = 6.2e-34
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+IS++L LQ+ +++d+ + e+ +E++n V +
CP000254_1 564 EVHHRVKNNLQIISGILKLQSMRIQDPRA-----AEIIQECRNQVYT 605

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA iHE LY s+d++++ + eY+++L+++ +q y++ s +++L+ +
CP000254_1 606 MASIHELLYNSKDIGKIQVEEYISRLVDHFKQEYEGISARLNLR--V 650

CP000254_2944: domain 1 of 1, from 681 to 749: score 116.6, E = 4.3e-33
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHRVKNN+Q+ISS+L LQ ++++de + l aL+++++R+ S
CP000254_2 681 ELHHRVKNNMQIISSMLQLQEEYITDEVI-----LSALHDCEQRIDS 722

mAliHEeLYksedldtvdfseYlekLt<-*
mAl+HE LY++e+l + f++Yle L+
CP000254_2 723 MALVHETLYRTESLAGIPFGQYLEDLA 749

CP000254_2552: domain 1 of 1, from 844 to 930: score 115.4, E = 9.2e-33
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNN+Q+I S+Lr+Q+ ++d+ v ++L+Es nR+lS
CP000254_2 844 EVHHRVKNNMQIIVSMLRIQSSMVDDPVV-----SDVLQESKNRILS 885

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA++HE+LY++++l ++++ eY++ L++ L++ ++ + + i L+ l
CP000254_2 886 MAIVHEKLYRTDNLVSINLLEYINSLARTLISDFSPDESLITLD--L 930

CP000254_0435: domain 1 of 1, from 451 to 534: score 106.6, E = 3e-30
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNN+Q+I+SLLrL ++ ++ev ++ r+++nR+ S
CP000254_0 451 EIHHRVKNNMQIIASLLRLTDFQSGNPEV-----HDVIRDCRNRIFS 492

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA iHE+LY+++dl +v +++Y++ + + ++ ++ + ++i l
CP000254_0 493 MASIHEKLYQTDDLAQVPLGSYIRDIGNRIILEFEMEEGRI-----L 534


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 6 0|=
-13 18 19|=*
-12 119 206|========== *
-11 703 574|===============================================*===========
-10 627 742|===================================================== *
-9 564 627|=============================================== *
-8 397 420|==================================*
-7 238 249|====================*
-6 257 139|===========*==========
-5 95 75|======*=
-4 47 39|===*
-3 26 20|=*=
-2 19 10|*=
-1 8 5|*
0 5 2|*
1 3 1|*
2 1 0|=
> 3 6 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 206.9009
P(chi-square) = 1.224e-37

Total sequences searched: 3139

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: