hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000264.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000264_2070 CDS_2080220-2079144 80.4 3.4e-27 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000264_2070 1/1 171 250 .. 1 85 [] 80.4 3.4e-27
Alignments of top-scoring domains:
CP000264_2070: domain 1 of 1, from 171 to 250: score 80.4, E = 3.4e-27
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN ++vV Si++Q+lR + +++++++RL A ++aH+
CP000264_2 171 ELNHRVKNAFTVVKSIVNQSLRKGSVEAGLRQTIDQRLNAYASAHSK 217
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt s+W+ A + ++ + P + ++R +++GPd
CP000264_2 218 --LTSSDWEHAAITTIAHDVVLPIA---DGRARIEGPD 250
Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-14 3 0|=
-13 37 0|===
-12 261 0|===================
-11 416 34|==*===========================
-10 619 435|===============================*=============
-9 790 1078|========================================================= *
-8 792 1119|========================================================= *
-7 516 751|===================================== *
-6 307 410|====================== *
-5 217 203|==============*=
-4 107 96|======*=
-3 72 44|===*==
-2 33 20|=*=
-1 20 9|*=
0 6 4|*
1 4 1|*
2 7 0|=
> 3 5 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4617.8662
P(chi-square) = 0
Total sequences searched: 4212
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K
