hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000267.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000267_0882 CDS_937478-939997 132.4 1.9e-37 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000267_0882 1/1 628 714 .. 1 94 [] 132.4 1.9e-37
Alignments of top-scoring domains:
CP000267_0882: domain 1 of 1, from 628 to 714: score 132.4, E = 1.9e-37
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQvI+SLLrL+a +++ +++ + +L + q+R++S
CP000267_0 628 EVHHRVKNNLQVITSLLRLEAGRSSQPDT-----KSVLTDMQGRIRS 669
mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE LY+++ + +vd+++Yl+ L+++ f++ + g+ +++L+ l
CP000267_0 670 MALLHESLYRTGTFASVDLGAYLKQLASQTFRAQSSGAVRLELE--L 714
Histogram of all scores:
score obs exp (one = represents 18 sequences)
----- --- ---
-15 4 0|=
-14 23 0|==
-13 47 26|=*=
-12 218 273|============= *
-11 1061 762|==========================================*================
-10 946 986|===================================================== *
-9 676 833|====================================== *
-8 558 559|===============================*
-7 245 332|============== *
-6 219 184|==========*==
-5 72 99|==== *
-4 47 52|==*
-3 28 27|=*
-2 12 14|*
-1 9 7|*
0 3 3|*
1 0 2|*
> 2 2 -|=
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 214.4299
P(chi-square) = 6.41e-309
Total sequences searched: 4170
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K