Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

1 accessions found for Janthinobacterium sp. Marseille  

Data for CP000269  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000269.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000269_1453 CDS_1640982-1639510 71.8 6.5e-21 1
CP000269_2917 CDS_3273652-3272588 66.8 1.9e-19 1
CP000269_0908 CDS_1030147-1032027 56.7 1.8e-16 1
CP000269_2611 CDS_2949226-2947190 32.1 3.3e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000269_1453 1/1 278 345 .. 1 70 [] 71.8 6.5e-21
CP000269_2917 1/1 148 215 .. 1 70 [] 66.8 1.9e-19
CP000269_0908 1/1 429 496 .. 1 70 [] 56.7 1.8e-16
CP000269_2611 1/1 460 522 .. 1 59 [. 32.1 3.3e-09

Alignments of top-scoring domains:
CP000269_1453: domain 1 of 1, from 278 to 345: score 71.8, E = 6.5e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD +g +L+aik+ l l+ r+l + e+ e ++ +
CP000269_1 278 ERTRIAREIHDDLGGNLTAIKMALALLTRRL--PGKSSELLEKAAYV 322

relarealaevRrllgdLRpaal<-*
+ l++++++ v r++gdLRp++l
CP000269_1 323 ESLVDRTIETVHRIAGDLRPGIL 345

CP000269_2917: domain 1 of 1, from 148 to 215: score 66.8, E = 1.9e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI+RELHD++gQsL+ai+++l++++++ + +++e + + +
CP000269_2 148 ERTRISRELHDELGQSLTAIRIGLSVIETQH--EMHDDEWLKSVSGL 192

relarealaevRrllgdLRpaal<-*
+++a+ + + v r++ dLRp +l
CP000269_2 193 KKIADSTVESVQRIAADLRPLIL 215

CP000269_0908: domain 1 of 1, from 429 to 496: score 56.7, E = 1.8e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER++IARELHD ++Q+Lsa+++ +++ + + + +++++
CP000269_0 429 ERKHIARELHDDLAQHLSALRMNVSVMKLEF--GHLSSAFSGQAETM 473

relarealaevRrllgdLRpaal<-*
e ++ +++ +R+++++LRp+al
CP000269_0 474 IERLDATIKIARNVITALRPTAL 496

CP000269_2611: domain 1 of 1, from 460 to 522: score 32.1, E = 3.3e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe......ear
E + IARELHD +g +L+a++++l+l+ +++ + +p ++++ +++
CP000269_2 460 EKRSIARELHDDLGSALTALNMHLSLLFQQM--PPEPKfterslKIK 504

ealdeirelarealaevR<-*
+ l i ++ r+ ++ +R
CP000269_2 505 ALLSSITDATRRIQNGLR 522


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 6 0|=
-13 51 0|====
-12 120 41|===*======
-11 185 338|=============== *
-10 513 786|======================================== *
-9 738 892|========================================================= *
-8 574 688|============================================= *
-7 493 432|=================================*====
-6 352 244|==================*=========
-5 311 131|==========*=============
-4 134 68|=====*=====
-3 88 35|==*====
-2 61 18|=*===
-1 25 9|*=
0 19 4|*=
1 11 2|*
2 4 1|*
3 1 0|=
4 0 0|
5 2 0|=
6 0 0|
7 1 0|=
8 2 0|=
9 0 0|
10 0 0|
> 11 6 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 933.0184
P(chi-square) = 0

Total sequences searched: 3697

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: