Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

3 accessions found for Burkholderia xenovorans LB400  

Data for CP000270  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000270.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000270_2576 CDS_2873369-2874721 68.1 9.8e-20 1
CP000270_2960 CDS_3306116-3307585 55.0 7.1e-16 1
CP000270_0535 CDS_606102-605011 52.5 3.7e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000270_2576 1/1 242 310 .. 1 70 [] 68.1 9.8e-20
CP000270_2960 1/1 272 339 .. 1 70 [] 55.0 7.1e-16
CP000270_0535 1/1 149 219 .. 1 70 [] 52.5 3.7e-15

Alignments of top-scoring domains:
CP000270_2576: domain 1 of 1, from 242 to 310: score 68.1, E = 9.8e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RIARELHD +gQ+L+a+k+ ++ ++++ld ++ +++re+l+ +
CP000270_2 242 EKTRIARELHDDLGQQLTALKMDISSVEQALD-GAASGPVREQLQGM 287

relarealaevRrllgdLRpaal<-*
r+l++ + a vRr++ dLRp l
CP000270_2 288 RRLIDVTVASVRRIAADLRPVML 310

CP000270_2960: domain 1 of 1, from 272 to 339: score 55.0, E = 7.1e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E + +ARELHD++g L+a k+ + +a r l ++ + + e l+++
CP000270_2 272 EKTQLARELHDELGAILTASKMDVAWANRKL--KDSEPDISEKLRRA 316

relarealaevRrllgdLRpaal<-*
+ +++++a Rr++ d+Rp++l
CP000270_2 317 LANLDQGIALKRRIIEDMRPTVL 339

CP000270_0535: domain 1 of 1, from 149 to 219: score 52.5, E = 3.7e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
E RIARELHD +gQ+L+a+k+ l ++ ++ ++ ++ + + ++
CP000270_0 149 EQIRIARELHDDIGQQLTALKMALAGLDSIV--RDQEAgaaRTAPHI 193

deirelarealaevRrllgdLRpaal<-*
+ +++l++ + a +Rr++ +LRp l
CP000270_0 194 ADMHQLIDATVASLRRIAAGLRPVML 219


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-14 6 0|=
-13 42 0|===
-12 111 49|===*====
-11 178 406|============= *
-10 598 942|=========================================== *
-9 804 1069|==========================================================*
-8 677 824|================================================= *
-7 596 518|====================================*======
-6 465 293|====================*=============
-5 421 157|===========*===================
-4 200 82|=====*=========
-3 126 42|==*======
-2 82 21|=*====
-1 46 10|*===
0 28 5|*=
1 16 2|*=
2 12 1|*
3 7 0|=
4 4 0|=
5 3 0|=
6 2 0|=
> 7 6 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1682.0763
P(chi-square) = 0

Total sequences searched: 4430

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: