Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Rhodopseudomonas palustris BisB5  

Data for CP000283  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000283.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000283_1363 CDS_1534981-1536636 126.2 8.9e-43 1
CP000283_3248 CDS_3620963-3621748 115.4 4.1e-39 1
CP000283_0741 CDS_832216-833667 115.3 4.3e-39 1
CP000283_0118 CDS_135261-133645 87.2 1.6e-29 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000283_1363 1/1 347 425 .. 1 85 [] 126.2 8.9e-43
CP000283_3248 1/1 69 151 .. 1 85 [] 115.4 4.1e-39
CP000283_0741 1/1 302 384 .. 1 85 [] 115.3 4.3e-39
CP000283_0118 1/1 352 431 .. 1 85 [] 87.2 1.6e-29

Alignments of top-scoring domains:
CP000283_1363: domain 1 of 1, from 347 to 425: score 126.2, E = 8.9e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LAv+QSi++ TlRn ++d ++e ++gR++A+s++ +L
CP000283_1 347 ELNHRVKNILAVIQSIVTRTLRNGSDMDVARELLIGRIHAMSNVVSL 393

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++s+W+g+ L+ L +a P+ ++Ri + GPd
CP000283_1 394 --LSESQWQGVLLKGLFAARAIPH----SDRIAVNGPD 425

CP000283_3248: domain 1 of 1, from 69 to 151: score 115.4, E = 4.1e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KN LA+V +i Q+lR+ + ++++ a++gRL AL+ aHdL
CP000283_3 69 ELHHRIKNMLATVIAITSQSLRGVKDAEHARLAIEGRLIALGKAHDL 115

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L +++Wa+AdL+++++ ++ ++++++ i ++GPd
CP000283_3 116 --LLQERWASADLGQIVRGAIKAFDDPGTSTIAVTGPD 151

CP000283_0741: domain 1 of 1, from 302 to 384: score 115.3, E = 4.3e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+V++i + T+ +++++++f ++FsgR+qAL+++H L
CP000283_0 302 ELDHRVKNTLAMVMAICARTAAHERTIEDFQRSFSGRIQALAATHTL 348

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ s+W+ ++++l aeLaP+++ ++Ri+ +G d
CP000283_0 349 --LSNSSWQNLQIKDVLGAELAPFASLSSGRIVTEGLD 384

CP000283_0118: domain 1 of 1, from 352 to 431: score 87.2, E = 1.6e-29
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KNt+A+VQ++a QTl++ ++++ v aFs+RL ALs aHd+
CP000283_0 352 ELSHRMKNTMALVQAVASQTLKSVPDKAP-VKAFSDRLLALSMAHDV 397

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + +W++A r ++ a++ ++ +R+ +sG++
CP000283_0 398 --LLQQDWRSAQVRNIVDAAICTFNE--VGRFDISGEQ 431


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-15 1 0|=
-14 14 0|=
-13 50 0|====
-12 349 0|=========================
-11 403 35|==*==========================
-10 646 454|================================*==============
-9 801 1125|==========================================================*
-8 763 1168|======================================================= *
-7 537 784|======================================= *
-6 322 428|======================= *
-5 214 212|===============*
-4 117 100|=======*=
-3 67 46|===*=
-2 51 21|=*==
-1 27 9|*=
0 11 4|*
1 5 2|*
2 6 0|=
3 4 0|=
4 1 0|=
5 1 0|=
6 0 0|
> 7 7 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4250.8726
P(chi-square) = 0

Total sequences searched: 4397

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: