Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

1 accessions found for Methylobacillus flagellatus KT  

Data for CP000284  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000284.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000284_0811 CDS_859869-861269 65.5 3.4e-19 1
CP000284_0443 CDS_453071-454882 61.8 4.4e-18 1
CP000284_0814 CDS_864185-862785 51.6 4.4e-15 1
CP000284_1984 CDS_2123464-2122025 48.8 3e-14 1
CP000284_1712 CDS_1837001-1835280 47.8 5.8e-14 1
CP000284_0945 CDS_995987-997399 46.8 1.1e-13 1
CP000284_1089 CDS_1139019-1140431 46.8 1.1e-13 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000284_0811 1/1 263 328 .. 1 70 [] 65.5 3.4e-19
CP000284_0443 1/1 402 470 .. 1 70 [] 61.8 4.4e-18
CP000284_0814 1/1 260 324 .. 1 70 [] 51.6 4.4e-15
CP000284_1984 1/1 273 340 .. 1 70 [] 48.8 3e-14
CP000284_1712 1/1 370 437 .. 1 70 [] 47.8 5.8e-14
CP000284_0945 1/1 272 339 .. 1 70 [] 46.8 1.1e-13
CP000284_1089 1/1 272 339 .. 1 70 [] 46.8 1.1e-13

Alignments of top-scoring domains:
CP000284_0811: domain 1 of 1, from 263 to 328: score 65.5, E = 3.4e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +AR+LHD++gQ L+a+ + +++++ +k e a+e +++i
CP000284_0 263 ERKNLARDLHDEIGQYLTAVHVDASAILN----AKSIENAKESAKAI 305

relarealaevRrllgdLRpaal<-*
+ ar+ ++ v ++l++LRp++l
CP000284_0 306 SAVARQMMDIVHDMLQRLRPSGL 328

CP000284_0443: domain 1 of 1, from 402 to 470: score 61.8, E = 4.4e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHDs++QsL+ +k+q+ +++++ e +e+
CP000284_0 402 ERAAIARELHDSLAQSLAYMKIQIARLQTQG--SGGQHDTNEITTEL 446

relarealaevRrllgdLR.paal<-*
re +++a++e+R+ll+++R +++
CP000284_0 447 REGLDTAYRELRELLSTFRmHMDV 470

CP000284_0814: domain 1 of 1, from 260 to 324: score 51.6, E = 4.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARE+HD+ gQ L+ai+l l + ++ + e ++i
CP000284_0 260 ERRNIAREIHDEMGQYLTAIRLELASLP-----KEGHSFIGEFSARI 301

relarealaevRrllgdLRpaal<-*
++++ ++ vR l+++LRp+al
CP000284_0 302 NSHVEHIQQAVRGLIHRLRPTAL 324

CP000284_1984: domain 1 of 1, from 273 to 340: score 48.8, E = 3e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IA+E HD +g +L+ai+l+l+ ++l + e + + ++++
CP000284_1 273 ERLKIAQEVHDDLGGNLTAIRLGLSSMIKRL--GPEQEVLLAKARQL 317

relarealaevRrllgdLRpaal<-*
+++++++ + + r+++dLRp +l
CP000284_1 318 EAIVDDTFEAAHRIASDLRPNVL 340

CP000284_1712: domain 1 of 1, from 370 to 437: score 47.8, E = 5.8e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD++gQ +aik + +++ + + + + ++ +++i
CP000284_1 370 ERRSLARELHDELGQYVTAIKTFAVAIANKA--KQEMPSIESSAQTI 414

relarealaevRrllgdLRpaal<-*
+a++ ++ + +++++LRp+ l
CP000284_1 415 VSAANHIYDGMHNIIRHLRPGSL 437

CP000284_0945: domain 1 of 1, from 272 to 339: score 46.8, E = 1.1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ +AR+LHD++g L+a k+ +++ r++ ++ ++e+ e ld
CP000284_0 272 ARQKLARDLHDELGSILTATKMDISWTIRRV--KDQDPEIVEKLDKT 316

relarealaevRrllgdLRpaal<-*
++ ++++++ R+++++L+p++
CP000284_0 317 MRYLNQGIQFKRQVVQNLHPSII 339

CP000284_1089: domain 1 of 1, from 272 to 339: score 46.8, E = 1.1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ +AR+LHD++g L+a k+ +++ r++ ++ ++e+ e ld
CP000284_1 272 ARQKLARDLHDELGSILTATKMDISWTIRRV--KDQDPEIVEKLDKT 316

relarealaevRrllgdLRpaal<-*
++ ++++++ R+++++L+p++
CP000284_1 317 MRYLNQGIQFKRQVVQNLHPSII 339


Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-14 5 0|=
-13 48 0|======
-12 75 30|===*=====
-11 144 252|================ *
-10 439 585|================================================= *
-9 480 664|====================================================== *
-8 415 512|=============================================== *
-7 349 322|===================================*===
-6 279 182|====================*==========
-5 191 97|==========*===========
-4 128 51|=====*=========
-3 80 26|==*======
-2 53 13|=*====
-1 21 6|*==
0 11 3|*=
1 8 1|*
2 5 0|=
3 5 0|=
4 7 0|=
> 5 10 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 731.3259
P(chi-square) = 0

Total sequences searched: 2753

Whole sequence top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: