Crenarchaeota Euryarchaeota Nanoarchaeota
Other Archaea
Classification of phyla is from NCBI page
Search:
54 projects found  

1 accessions found for Methanococcoides burtonii DSM 6242  

Data for CP000300  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000300.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000300_0834 CDS_979255-982230 177.5 8.3e-51 1
CP000300_2122 CDS_2412818-2410314 162.5 2.7e-46 1
CP000300_0771 CDS_888693-886510 143.5 6.9e-41 1
CP000300_1757 CDS_1993180-1991792 141.6 2.3e-40 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000300_0834 1/1 800 888 .. 1 94 [] 177.5 8.3e-51
CP000300_2122 1/1 637 725 .. 1 94 [] 162.5 2.7e-46
CP000300_0771 1/1 534 618 .. 1 94 [] 143.5 6.9e-41
CP000300_1757 1/1 271 357 .. 1 94 [] 141.6 2.3e-40

Alignments of top-scoring domains:
CP000300_0834: domain 1 of 1, from 800 to 888: score 177.5, E = 8.3e-51
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvISSLL+LQ+r+f de+v ++a++EsqnRV+S
CP000300_0 800 EIHHRVKNNLQVISSLLNLQSRNFNDEKV-----IAAFMESQNRVRS 841

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA+ H++LY+s dl ++++++Y+++Lt +Lfq+y+vg+ i+LklD+
CP000300_0 842 MAIAHQKLYQSNDLASIEVGDYIKNLTTYLFQTYRVGNRAIKLKLDI 888

CP000300_2122: domain 1 of 1, from 637 to 725: score 162.5, E = 2.7e-46
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvIS LL L+++kfkde+v ++a++ sq+RV++
CP000300_2 637 EIHHRIKNNLQVISTLLYLESDKFKDEKV-----RDAFKNSQDRVRT 678

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE+LY+sed++++df +Y ++L+++L qsy g+ +i ++lD+
CP000300_2 679 MALVHEKLYQSEDMESIDFVDYTKNLINYLSQSYVIGNRNITIDLDV 725

CP000300_0771: domain 1 of 1, from 534 to 618: score 143.5, E = 6.9e-41
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQv+S++L L++ +f+ +ev ++a+r+s+nRV+S
CP000300_0 534 EIHHRIKNNLQVVSGMLYLESLNFRYQEV-----IDAFRDSENRVRS 575

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+AliHE+LY+s+dl ++d+++Y++ Lt++Lf+sy+ + ++i+ l
CP000300_0 576 IALIHEKLYQSKDLVSLDLADYIKDLTDHLFHSYRIDEKNIE----L 618

CP000300_1757: domain 1 of 1, from 271 to 357: score 141.6, E = 2.3e-40
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQ+I+SLL+L+a +f+d+ v ++a++Es++R+ S
CP000300_1 271 EIHHRIKNNLQIIASLLDLEASNFTDPQV-----INAFKESRDRIHS 312

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+++ HEeLY+s+d+ +v f +Y + +t++L q g ++++i+L+ +
CP000300_1 313 ISIAHEELYRSRDMTNVAFQDYAKDVTNYLYQMNGQQAKNIKLR--M 357


Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-15 1 0|=
-14 4 0|=
-13 19 14|=*=
-12 80 149|========= *
-11 448 415|==============================================*===
-10 489 537|======================================================= *
-9 472 454|==================================================*==
-8 314 304|=================================*=
-7 196 181|====================*=
-6 139 100|===========*====
-5 48 54|=====*
-4 21 28|===*
-3 21 15|=*=
-2 6 7|*
-1 6 4|*
0 3 2|*
1 1 1|*
> 2 5 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 62.9700
P(chi-square) = 2.59e-09

Total sequences searched: 2273

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: