Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Rhodopseudomonas palustris BisB18  

Data for CP000301  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000301.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000301_3814 CDS_4292280-4293878 135.5 2.8e-38 1
CP000301_2841 CDS_3124785-3125873 106.8 4e-30 1
CP000301_3489 CDS_3923391-3924608 92.7 4.2e-26 1
CP000301_2263 CDS_2488137-2486935 92.6 4.4e-26 1
CP000301_4352 CDS_4916648-4915422 92.5 4.6e-26 1
CP000301_2240 CDS_2465849-2466946 64.2 5.4e-18 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000301_3814 1/1 337 423 .. 1 94 [] 135.5 2.8e-38
CP000301_2841 1/1 160 243 .. 1 94 [] 106.8 4e-30
CP000301_3489 1/1 213 295 .. 1 94 [] 92.7 4.2e-26
CP000301_2263 1/1 207 289 .. 1 94 [] 92.6 4.4e-26
CP000301_4352 1/1 210 294 .. 1 94 [] 92.5 4.6e-26
CP000301_2240 1/1 167 250 .. 1 94 [] 64.2 5.4e-18

Alignments of top-scoring domains:
CP000301_3814: domain 1 of 1, from 337 to 423: score 135.5, E = 2.8e-38
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQv SSL+r+Q ++f++++ ++aLr++q+R +S
CP000301_3 337 EIHHRVKNNLQVTSSLIRMQEQRFTEPAF-----KAALRDTQDRLQS 378

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+AliHE LY+ + +tvd+ +Y+e+L++++ ++yg +s gis++ l
CP000301_3 379 IALIHESLYRADAGSTVDLPDYFERLVGDIAEAYGAKSRGISIE--L 423

CP000301_2841: domain 1 of 1, from 160 to 243: score 106.8, E = 4e-30
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+LQ+I+SLL LQa ++k +v ++aL + +RV++
CP000301_2 160 EVNHRVGNSLQIIASLLHLQASSSKQADV-----KAALTNAMGRVAA 201

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++LY+s dl++v + +Yle L+e+L++s+++ + l
CP000301_2 202 VAQVHRRLYTSHDLKSVLLNQYLEALLEDLRRSAEGNRMSR-----L 243

CP000301_3489: domain 1 of 1, from 213 to 295: score 92.7, E = 4.2e-26
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+L + +LLr Qar +++ +v ++aL+ + RV+S
CP000301_3 213 EMSHRVKNSLTSVVGLLRVQARGSDSVDV-----KNALENAAMRVAS 254

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H++L+++ ++ vd+s+++ L++nL +s+ s+ +
CP000301_3 255 IAEVHDHLWRGSKVGFVDLSDFVGHLCKNLQNSAPEHSIQ------C 295

CP000301_2263: domain 1 of 1, from 207 to 289: score 92.6, E = 4.4e-26
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+L + +LLr Q+r + +++v ++aL ++ +RV++
CP000301_2 207 EMSHRVKNSLTSVVGLLRVQSRGAVSQDV-----KDALDDASSRVAT 248

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++L+++ ++ v++ ++l +L++nL +g+ + +
CP000301_2 249 IAQVHDHLWRGNKIGFVELTDFLAELCRNLQANAGGHTLR------C 289

CP000301_4352: domain 1 of 1, from 210 to 294: score 92.5, E = 4.6e-26
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HR+KN+L+ + +LLr Q+r++ + +v ++aL+E+ +RV++
CP000301_4 210 EMSHRIKNSLASVVGLLRVQSRSAHSDDV-----RAALQEASSRVAT 251

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H+ L ++ ++ +d+++++e+ ++ L ++++ +
CP000301_4 252 IAQVHDNLARGSRIGFIDLADFIEEFCGRLQATANGNQLCFR----A 294

CP000301_2240: domain 1 of 1, from 167 to 250: score 64.2, E = 5.4e-18
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRVKNNLQ+I++L+rL+ar++ + e aL +R+ +
CP000301_2 167 ELQHRVKNNLQLITALVRLEARSAAEGE------SVALARLASRIDA 207

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+++ L+ ++++d+++Yl +++ +q+ + s+ i+ +
CP000301_2 208 LTVLYRILSAENAVGDIDLGQYLADVADAVMQANAMPSIEIN----V 250


Histogram of all scores:
score obs exp (one = represents 23 sequences)
----- --- ---
-15 5 0|=
-14 25 0|==
-13 81 30|=*==
-12 330 320|=============*=
-11 1332 893|======================================*===================
-10 1017 1156|============================================= *
-9 836 976|===================================== *
-8 551 655|======================== *
-7 302 389|============== *
-6 218 216|=========*
-5 80 116|==== *
-4 40 61|==*
-3 28 32|=*
-2 19 16|*
-1 8 8|*
0 2 4|*
1 2 2|*
> 2 10 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 391.7849
P(chi-square) = 0

Total sequences searched: 4886

Whole sequence top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: