Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

3 accessions found for Polaromonas sp. JS666  

Data for CP000316  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000316.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000316_4222 CDS_4532556-4531513 66.7 2.7e-19 1
CP000316_4515 CDS_4877976-4876063 65.9 4.7e-19 1
CP000316_0869 CDS_901583-900243 54.7 9.6e-16 1
CP000316_0755 CDS_787361-785967 53.7 1.8e-15 1
CP000316_0292 CDS_310040-308808 49.0 4.5e-14 1
CP000316_0699 CDS_720561-722222 47.8 9.8e-14 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000316_4222 1/1 144 211 .. 1 70 [] 66.7 2.7e-19
CP000316_4515 1/1 422 490 .. 1 70 [] 65.9 4.7e-19
CP000316_0869 1/1 250 317 .. 1 70 [] 54.7 9.6e-16
CP000316_0755 1/1 249 316 .. 1 70 [] 53.7 1.8e-15
CP000316_0292 1/1 198 276 .. 1 70 [] 49.0 4.5e-14
CP000316_0699 1/1 347 410 .. 5 70 .] 47.8 9.8e-14

Alignments of top-scoring domains:
CP000316_4222: domain 1 of 1, from 144 to 211: score 66.7, E = 2.7e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RIARELHD+++QsL+a+k+ + ++r +l ++ +++a++ l +
CP000316_4 144 EKTRIARELHDELAQSLTALKMDAIWVRDQL--PEGAQAAAAKLGDM 188

relarealaevRrllgdLRpaal<-*
++++++ a +Rr+++dLRp l
CP000316_4 189 LAMLDTTVAATRRIASDLRPLLL 211

CP000316_4515: domain 1 of 1, from 422 to 490: score 65.9, E = 4.7e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ERa +AR LHDs++QsL+ +k+q++l+r+++ +k e++++ alde
CP000316_4 422 ERALLARNLHDSIAQSLAFLKIQVQLLRTAV--QKGQEpQVQGALDE 466

irelarealaevRrllgdLRpaal<-*
+ +re++ +vR+ll ++R+ +
CP000316_4 467 LDLGLRESIGDVRELLVHFRTRTN 490

CP000316_0869: domain 1 of 1, from 250 to 317: score 54.7, E = 9.6e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER ++ARELHD++g L+a+kl + ++r +l + + +ea+e+l+ +
CP000316_0 250 ERGHLARELHDELGALLTAAKLDVARLRSRL--AGNLPEAAERLEHL 294

relarealaevRrllgdLRpaal<-*
+++ ++a Rr++ dLRp+ l
CP000316_0 295 TSTLNSGIALKRRIVEDLRPSSL 317

CP000316_0755: domain 1 of 1, from 249 to 316: score 53.7, E = 1.8e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa++ARELHD++g L+a+kl + ++++ l d+ ++++++ +
CP000316_0 249 ERAHLARELHDELGALLTAAKLDVARIKAKL--SGDASDLQARIQHL 293

relarealaevRrllgdLRpaal<-*
e+++ ++a Rr++ dLRp+ l
CP000316_0 294 VETLNSGIALKRRIIEDLRPSSL 316

CP000316_0292: domain 1 of 1, from 198 to 276: score 49.0, E = 4.5e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrllds....dkdpe.....
ER+RIARE HD++g L a+k+ ++++ ++l +++++++ +e ++ +
CP000316_0 198 ERTRIAREVHDELGSLLVALKMDVGWLDKRL-GeqqqRSLDEaqsmr 243

.earealdeirelarealaevRrllgdLRpaal<-*
++ r +++ +l++ a + v r+++dLRp++l
CP000316_0 244 eRMRSKCQNMGRLIEAAVDNVGRIITDLRPSIL 276

CP000316_0699: domain 1 of 1, from 347 to 410: score 47.8, E = 9.8e-14
*->IARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeirela
I RELHD++gQ+L++++l + ++++ l ++ +++ +ea+++i el+
CP000316_0 347 IGRELHDGLGQHLTGLALFSATLQQKL--HERAQPEAEAARRIVELV 391

realaevRrllgdLRpaal<-*
++a a +R ++++L paal
CP000316_0 392 NQATAMTRSVARGLYPAAL 410


Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-14 6 0|=
-13 45 0|===
-12 126 53|===*=====
-11 191 441|============= *
-10 610 1024|========================================= *
-9 876 1163|==========================================================*
-8 746 896|================================================== *
-7 707 563|=====================================*==========
-6 509 319|=====================*============
-5 456 171|===========*===================
-4 218 89|=====*=========
-3 123 45|==*======
-2 76 23|=*====
-1 48 11|*===
0 26 6|*=
1 14 3|*
2 13 1|*
3 8 0|=
4 4 0|=
5 0 0|
6 1 0|=
7 0 0|
8 3 0|=
> 9 11 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1733.2036
P(chi-square) = 0

Total sequences searched: 4817

Whole sequence top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: