Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

4 accessions found for Nitrobacter hamburgensis X14  

Data for CP000319  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000319.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000319_2082 CDS_2439932-2441020 108.8 8.4e-31 1
CP000319_2414 CDS_2792914-2791844 83.9 1e-23 1
CP000319_1106 CDS_1324643-1323570 34.7 9.9e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000319_2082 1/1 159 244 .. 1 94 [] 108.8 8.4e-31
CP000319_2414 1/1 154 240 .. 1 94 [] 83.9 1e-23
CP000319_1106 1/1 164 214 .. 1 56 [. 34.7 9.9e-10

Alignments of top-scoring domains:
CP000319_2082: domain 1 of 1, from 159 to 244: score 108.8, E = 8.4e-31
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+LQ+I+SLL LQa ++ +e++ ++aL + +RV++
CP000319_2 159 EVNHRVGNSLQIIASLLHLQANSSPEEDI-----KAALTAAMGRVAA 200

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++LY+s dl++v + +Yle L+e+L++s+++ + L+ l
CP000319_2 201 VAQVHRRLYTSHDLKSVLLNQYLEALLEDLRRSAEGNRMSR-LD--L 244

CP000319_2414: domain 1 of 1, from 154 to 240: score 83.9, E = 1e-23
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HR+ N+LQ+I+S++ + a +++ee+ + +L++++ RV+S
CP000319_2 154 ELQHRISNSLQIIASIILMKAKTVESEET-----RVHLQDAHKRVMS 195

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A ++++L+ s+ + +++ +Yl++L+e L s+ ++ isLk +
CP000319_2 196 VAAVQQQLHGSGASGPIEMVPYLSRLCETLATSMIGDTRPISLK--V 240

CP000319_1106: domain 1 of 1, from 164 to 214: score 34.7, E = 9.9e-10
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N LQ++SS L+ Qa + +eev aL+ + +RV+
CP000319_1 164 EMNHRVGNQLQLVSSFLMRQASSNCNEEV-----GRALERAGSRVMV 205

mAliHEeLY<-*
+ i++ L+
CP000319_1 206 IGNIQRLLS 214


Histogram of all scores:
score obs exp (one = represents 18 sequences)
----- --- ---
-15 3 0|=
-14 20 0|==
-13 75 23|=*===
-12 257 249|=============*=
-11 1024 695|======================================*==================
-10 798 900|============================================= *
-9 606 760|================================== *
-8 437 510|========================= *
-7 240 302|============== *
-6 207 168|=========*==
-5 63 90|====*
-4 25 48|==*
-3 25 25|=*
-2 5 13|*
-1 7 6|*
0 0 3|*
1 1 1|*
2 3 0|=
3 0 0|
4 0 0|
> 5 8 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 365.1007
P(chi-square) = 0

Total sequences searched: 3804

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: