Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

4 accessions found for Nitrobacter hamburgensis X14  

Data for CP000322  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000322.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000322_0054 CDS_61258-57980 92.0 9.5e-33 1
CP000322_0063 CDS_74013-72649 72.6 4.1e-26 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000322_0054 1/1 868 950 .. 1 85 [] 92.0 9.5e-33
CP000322_0063 1/1 256 348 .. 1 85 [] 72.6 4.1e-26

Alignments of top-scoring domains:
CP000322_0054: domain 1 of 1, from 868 to 950: score 92.0, E = 9.5e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR N++ v+Q++arQT++++a ++f +F +R+q Ls++ L
CP000322_0 868 ELQHRTNNLFRVIQAMARQTAKHSANFADFEVQFGARIQGLSESNTL 914

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L +W++++L L++ +LaP+ g d+ R++++G +
CP000322_0 915 --LIGQNWQSVSLERLVRTQLAPFIGTDQARLEIDGLA 950

CP000322_0063: domain 1 of 1, from 256 to 348: score 72.6, E = 4.1e-26
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN++A+ ++++ ++R+a++++e+++a+ gRL AL++aH L
CP000322_0 256 EMDHRIKNLFAITSGVVSLSARSATTPKEMATAIQGRLGALASAHQL 302

V.p..LtrseWag.AdLreLleaeLaPygge.d...aeRitlsGPd<-*
V+p++L ++ + ++L+++++ L+Py + +d+++++R +++GPd
CP000322_0 303 VrPrrLEAGSANPiVTLADIIQTVLRPYSATeDprdEPRSVIEGPD 348


Histogram of all scores:
score obs exp (one = represents 1 sequences)
----- --- ---
-13 1 0|=
-12 9 0|=========
-11 18 0|==================
-10 13 11|==========*==
-9 21 28|===================== *
-8 19 29|=================== *
-7 13 19|============= *
-6 7 10|======= *
-5 5 5|====*
-4 1 2|=*
-3 0 1|*
-2 0 0|
-1 1 0|=
0 0 0|
> 1 3 -|===


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 9.5806
P(chi-square) = 0.08803

Total sequences searched: 111

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: