Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
19 projects found  

2 accessions found for Leptospira borgpetersenii serovar Hardjo-bovis JB197  

Data for CP000350  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000350.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000350_0078 CDS_106588-108768 150.9 6.4e-43 1
CP000350_1477 CDS_1987550-1986138 145.0 3.1e-41 1
CP000350_0259 CDS_349424-350803 127.5 2.8e-36 1
CP000350_1766 CDS_2376580-2375495 83.9 7.1e-24 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000350_0078 1/1 525 608 .. 1 94 [] 150.9 6.4e-43
CP000350_1477 1/1 277 362 .. 1 94 [] 145.0 3.1e-41
CP000350_0259 1/1 266 351 .. 1 94 [] 127.5 2.8e-36
CP000350_1766 1/1 176 256 .. 1 94 [] 83.9 7.1e-24

Alignments of top-scoring domains:
CP000350_0078: domain 1 of 1, from 525 to 608: score 150.9, E = 6.4e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvISSLL++Q+++++d+ l ++ EsqnR ++
CP000350_0 525 EIHHRVKNNLQVISSLLSMQSDYVQDKQS-----LSVFIESQNRLRT 566

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m++iHEeLY+se+l+++ s Y+ekL+++Lfq yg++++ + l
CP000350_0 567 MSMIHEELYQSENLGKIQYSVYIEKLLNQLFQVYGKSDSVV-----L 608

CP000350_1477: domain 1 of 1, from 277 to 362: score 145.0, E = 3.1e-41
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQv++SLL LQa+++++e++ +L+E+++R++S
CP000350_1 277 EIHHRVKNNLQVVASLLGLQAEYSQNEKI-----SLILKECERRIQS 318

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliH+eLY+se++ ++df +Yl+ L+ +L++s+g++++ +++D+
CP000350_1 319 MALIHKELYQSENITKIDFCDYLNTLLISLLHSFGKEKK---VEFDI 362

CP000350_0259: domain 1 of 1, from 266 to 351: score 127.5, E = 2.8e-36
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNL +ISS+ +L + ++ dee ++LrEsqnR ++
CP000350_0 266 EIHHRIKNNLTIISSIFSLRSGQA-DEES-----NDILRESQNRLRA 306

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE LY+s+dl+++ f Y++kLt+ Lf+ y+v++++i+L+ l
CP000350_0 307 VALLHEILYESKDLSSISFELYVKKLTDALFEIYQVDREKIRLD--L 351

CP000350_1766: domain 1 of 1, from 176 to 256: score 83.9, E = 7.1e-24
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRV+NNLQv L +L+ +d +++L +qnR+l+
CP000350_1 176 EIHHRVRNNLQVLCVLADLHKNDWSDS-------KKVLIKFQNRILA 215

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+ +H++LYks+++ +++fse++e++++++++ ++d+ +++ +
CP000350_1 216 MSEVHNYLYKSDNYHKIEFSEVIERIVADMKN----KNDDFKVN--V 256


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 5 0|=
-13 18 16|=*
-12 73 173|======== *
-11 563 483|================================================*========
-10 498 626|================================================== *
-9 474 528|================================================ *
-8 336 354|================================== *
-7 216 210|====================*=
-6 300 117|===========*==================
-5 70 63|======*
-4 42 33|===*=
-3 22 17|=*=
-2 10 9|*
-1 2 4|*
0 3 2|*
1 2 1|*
2 3 0|=
> 3 8 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 392.9192
P(chi-square) = 0

Total sequences searched: 2645

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: