Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Sphingopyxis alaskensis RB2256  

Data for CP000356  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000356.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000356_2072 CDS_2193821-2195500 70.4 6.2e-24 1
CP000356_0285 CDS_285198-286742 67.0 8.8e-23 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000356_2072 1/1 364 446 .. 1 85 [] 70.4 6.2e-24
CP000356_0285 1/1 326 403 .. 1 85 [] 67.0 8.8e-23

Alignments of top-scoring domains:
CP000356_2072: domain 1 of 1, from 364 to 446: score 70.4, E = 6.2e-24
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+ HR KN +A + ++ar TlR +asldef ++F+gR +ALs a +
CP000356_2 364 EMAHRMKNAFARIGALARITLRESASLDEFEAKFDGRMRALSDAKQM 410

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ ++L ++ +eL+ g + ++ ++GP+
CP000356_2 411 --LVTGAVDTVELERIVHRELDLAGVPPDRLAAITGPA 446

CP000356_0285: domain 1 of 1, from 326 to 403: score 67.0, E = 8.8e-23
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N++A+V +i+ T++ a+++d++ve++s RL AL ra+++
CP000356_0 326 ELHHRMRNLFATVGAIISLTRHAARDVDDYVERISSRLDALNRAQNV 372

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++ + +++++Ll++ a + +Ri++sGPd
CP000356_0 373 --LLGANFMTGSMHALLREVEASF-----PRIHWSGPD 403


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 7 0|=
-13 32 0|===
-12 222 0|=====================
-11 283 25|==*=======================
-10 457 327|=============================*============
-9 559 810|=================================================== *
-8 603 840|======================================================= *
-7 412 564|====================================== *
-6 242 308|====================== *
-5 138 152|=============*
-4 87 72|======*=
-3 54 33|==*==
-2 39 15|=*==
-1 12 7|*=
0 8 3|*
1 2 1|*
2 3 0|=
3 2 0|=
4 0 0|
> 5 3 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2864.4270
P(chi-square) = 0

Total sequences searched: 3165

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: