Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
7 projects found  

3 accessions found for   

Data for CP000359  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000359.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000359_0183 CDS_173682-172510 94.6 7.8e-28 1
CP000359_1982 CDS_2093902-2095626 90.3 1.4e-26 1
CP000359_1697 CDS_1813191-1814885 81.5 5.8e-24 1
CP000359_0554 CDS_591991-594960 52.3 2.3e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000359_0183 1/1 178 245 .. 1 70 [] 94.6 7.8e-28
CP000359_1982 1/1 374 441 .. 1 70 [] 90.3 1.4e-26
CP000359_1697 1/1 362 429 .. 1 70 [] 81.5 5.8e-24
CP000359_0554 1/1 796 860 .. 1 70 [] 52.3 2.3e-15

Alignments of top-scoring domains:
CP000359_0183: domain 1 of 1, from 178 to 245: score 94.6, E = 7.8e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD +g++Ls+i l++ela +l+ ++dp++a ++++e+
CP000359_0 178 ERERIARDLHDLLGHTLSVIVLKSELASKLA--QRDPARAVQEIREV 222

relarealaevRrllgdLRpaal<-*
++++real+evR++++++R ++l
CP000359_0 223 ERISREALSEVRAAVSGYRGSGL 245

CP000359_1982: domain 1 of 1, from 374 to 441: score 90.3, E = 1.4e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD+v+QsL+ +l+l+l++r+l ++dpe+a+++++++
CP000359_1 374 ERARIAREIHDGVAQSLAFCALKLDLVARQL--HSDPEKAEAEVKAA 418

relarealaevRrllgdLRpaal<-*
+l+re ++evRr + +LRp +l
CP000359_1 419 TGLLREQIREVRRSIFALRPIDL 441

CP000359_1697: domain 1 of 1, from 362 to 429: score 81.5, E = 5.8e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHDsv+Q+L +i+l++ +ar+ l +dpe+ r+ ld
CP000359_1 362 ERARLARELHDSVAQALYGITLGAKTARATL--GRDPEKTRASLDYT 406

relarealaevRrllgdLRpaal<-*
+la+ + +e+ +ll LRp+al
CP000359_1 407 IRLAEGGVSEMKALLFSLRPDAL 429

CP000359_0554: domain 1 of 1, from 796 to 860: score 52.3, E = 2.3e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI+RELHD +Q L a + + +++ ++ ++ re++ i
CP000359_0 796 ERRRISRELHDDTAQVLVATSRRVARLA-----RDLEGPQRERANDI 837

relarealaevRrllgdLRpaal<-*
+ ++ a++ vRr +++LRp++l
CP000359_0 838 LGDLNAAIESVRRFARNLRPSVL 860


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 2 0|=
-13 8 0|==
-12 28 26|====*
-11 55 214|========== *
-10 205 496|=================================== *
-9 338 563|========================================================= *
-8 330 434|======================================================= *
-7 348 273|=============================================*============
-6 296 154|=========================*========================
-5 289 82|=============*===================================
-4 138 43|=======*===============
-3 103 22|===*==============
-2 69 11|=*==========
-1 44 5|*=======
0 23 2|*===
1 25 1|*====
2 11 0|==
3 6 0|=
4 3 0|=
5 4 0|=
6 1 0|=
7 0 0|
> 8 9 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2110.3669
P(chi-square) = 0

Total sequences searched: 2335

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: