Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
3 projects found  

1 accessions found for Candidatus Koribacter versatilis Ellin345  

Data for CP000360  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_1.hmm [HisKA]
Sequence database: CP000360.Gprot.fsa
per-sequence score cutoff: >= 26.8 [TC1]
per-domain score cutoff: >= 26.8 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA
Accession: PF00512.12
Description: His Kinase A (phosphoacceptor) domain
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000360_2395 CDS_2843683-2840288 105.3 2e-29 2
CP000360_4054 CDS_4800189-4804169 99.0 1.2e-27 1
CP000360_2408 CDS_2855794-2853983 97.2 3.9e-27 1
CP000360_2985 CDS_3541549-3539792 93.0 6.1e-26 1
CP000360_3499 CDS_4133242-4136373 88.0 1.6e-24 1
CP000360_0310 CDS_334630-333176 70.8 1.2e-19 2
CP000360_2493 CDS_2954246-2950740 69.5 2.8e-19 1
CP000360_1772 CDS_2151748-2155515 68.5 5.3e-19 1
CP000360_1386 CDS_1686822-1685170 68.4 5.5e-19 1
CP000360_4191 CDS_4972893-4970851 67.2 1.3e-18 1
CP000360_4456 CDS_5293240-5294598 62.5 2.6e-17 1
CP000360_4452 CDS_5289640-5287844 59.6 1.8e-16 1
CP000360_3058 CDS_3639075-3637087 59.2 2.3e-16 1
CP000360_3353 CDS_3984302-3981390 57.2 8.5e-16 1
CP000360_4050 CDS_4795109-4796869 57.2 8.6e-16 1
CP000360_3840 CDS_4555640-4554276 56.3 1.5e-15 1
CP000360_4164 CDS_4936462-4935554 54.7 4.2e-15 1
CP000360_0474 CDS_590316-588037 53.6 8.7e-15 1
CP000360_3271 CDS_3880179-3882074 52.8 1.5e-14 1
CP000360_1587 CDS_1938978-1937635 52.7 1.6e-14 1
CP000360_2599 CDS_3070624-3072336 52.3 2.1e-14 1
CP000360_3010 CDS_3576953-3573555 50.9 5.2e-14 1
CP000360_0507 CDS_624843-623407 50.1 8.6e-14 1
CP000360_0750 CDS_925739-926911 49.2 1.6e-13 1
CP000360_1808 CDS_2190510-2192171 48.8 2.1e-13 1
CP000360_4556 CDS_5409065-5407743 47.8 3.9e-13 1
CP000360_3596 CDS_4260608-4258308 46.9 7e-13 1
CP000360_0520 CDS_642001-644256 45.8 1.5e-12 1
CP000360_3096 CDS_3684086-3685516 42.7 1.1e-11 1
CP000360_0936 CDS_1194386-1195846 42.1 1.6e-11 1
CP000360_2550 CDS_3016637-3014982 40.5 4.6e-11 1
CP000360_3232 CDS_3833032-3835209 38.4 1.8e-10 1
CP000360_3708 CDS_4387092-4389647 37.2 3.9e-10 1
CP000360_3711 CDS_4391470-4393689 37.1 4.2e-10 1
CP000360_0666 CDS_824300-826795 36.3 7.2e-10 1
CP000360_1390 CDS_1692161-1694431 36.2 7.6e-10 1
CP000360_1810 CDS_2192645-2193790 34.3 2.6e-09 1
CP000360_2399 CDS_2847478-2845379 33.9 3.4e-09 1
CP000360_1777 CDS_2159383-2160075 33.9 3.5e-09 1
CP000360_0711 CDS_874808-875416 33.7 3.8e-09 1
CP000360_3515 CDS_4162917-4159954 32.9 6.5e-09 1
CP000360_2777 CDS_3294838-3295803 32.8 7e-09 1
CP000360_1729 CDS_2101992-2103776 32.6 8e-09 1
CP000360_3014 CDS_3582559-3580991 32.3 9.4e-09 1
CP000360_0843 CDS_1046364-1048505 31.7 1.4e-08 1
CP000360_2407 CDS_2853982-2852489 31.1 2.2e-08 1
CP000360_0933 CDS_1191327-1188841 30.0 4.3e-08 1
CP000360_2891 CDS_3439313-3437196 27.6 2e-07 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000360_4054 1/1 585 650 .. 1 87 [] 99.0 1.2e-27
CP000360_2408 1/1 222 290 .. 1 87 [] 97.2 3.9e-27
CP000360_2985 1/1 347 413 .. 1 87 [] 93.0 6.1e-26
CP000360_3499 1/1 796 864 .. 1 87 [] 88.0 1.6e-24
CP000360_2493 1/1 801 866 .. 1 87 [] 69.5 2.8e-19
CP000360_1772 1/1 1027 1093 .. 1 87 [] 68.5 5.3e-19
CP000360_1386 1/1 317 383 .. 1 87 [] 68.4 5.5e-19
CP000360_0310 2/2 240 306 .. 1 87 [] 68.1 7e-19
CP000360_2395 1/2 367 435 .. 1 87 [] 67.2 1.3e-18
CP000360_4191 1/1 454 519 .. 1 87 [] 67.2 1.3e-18
CP000360_4456 1/1 215 279 .. 1 87 [] 62.5 2.6e-17
CP000360_4452 1/1 376 442 .. 1 87 [] 59.6 1.8e-16
CP000360_3058 1/1 414 481 .. 1 87 [] 59.2 2.3e-16
CP000360_3353 1/1 745 811 .. 1 87 [] 57.2 8.5e-16
CP000360_4050 1/1 356 422 .. 1 87 [] 57.2 8.6e-16
CP000360_3840 1/1 229 289 .. 1 87 [] 56.3 1.5e-15
CP000360_4164 1/1 74 132 .. 1 79 [. 54.7 4.2e-15
CP000360_0474 1/1 532 597 .. 1 87 [] 53.6 8.7e-15
CP000360_3271 1/1 396 463 .. 1 87 [] 52.8 1.5e-14
CP000360_1587 1/1 229 293 .. 1 87 [] 52.7 1.6e-14
CP000360_2599 1/1 329 403 .. 1 87 [] 52.3 2.1e-14
CP000360_3010 1/1 759 825 .. 1 87 [] 50.9 5.2e-14
CP000360_0507 1/1 253 320 .. 1 87 [] 50.1 8.6e-14
CP000360_0750 1/1 168 234 .. 1 87 [] 49.2 1.6e-13
CP000360_1808 1/1 322 389 .. 1 87 [] 48.8 2.1e-13
CP000360_4556 1/1 212 274 .. 1 87 [] 47.8 3.9e-13
CP000360_3596 1/1 393 459 .. 1 87 [] 46.9 7e-13
CP000360_0520 1/1 374 440 .. 1 87 [] 45.8 1.5e-12
CP000360_3096 1/1 255 320 .. 1 87 [] 42.7 1.1e-11
CP000360_0936 1/1 263 331 .. 1 87 [] 42.1 1.6e-11
CP000360_2550 1/1 185 251 .. 1 87 [] 40.5 4.6e-11
CP000360_3232 1/1 373 439 .. 1 87 [] 38.4 1.8e-10
CP000360_2395 2/2 911 977 .. 1 87 [] 38.1 2.1e-10
CP000360_3708 1/1 626 696 .. 1 87 [] 37.2 3.9e-10
CP000360_3711 1/1 511 581 .. 1 87 [] 37.1 4.2e-10
CP000360_0666 1/1 459 525 .. 1 87 [] 36.3 7.2e-10
CP000360_1390 1/1 516 590 .. 1 87 [] 36.2 7.6e-10
CP000360_1810 1/1 142 208 .. 1 87 [] 34.3 2.6e-09
CP000360_2399 1/1 484 548 .. 1 87 [] 33.9 3.4e-09
CP000360_1777 1/1 140 204 .. 1 87 [] 33.9 3.5e-09
CP000360_0711 1/1 135 194 .. 1 79 [. 33.7 3.8e-09
CP000360_3515 1/1 759 825 .. 1 87 [] 32.9 6.5e-09
CP000360_2777 1/1 93 157 .. 1 87 [] 32.8 7e-09
CP000360_1729 1/1 366 437 .. 1 87 [] 32.6 8e-09
CP000360_3014 1/1 143 209 .. 1 87 [] 32.3 9.4e-09
CP000360_0843 1/1 486 556 .. 1 87 [] 31.7 1.4e-08
CP000360_2407 1/1 272 338 .. 1 87 [] 31.1 2.2e-08
CP000360_0933 1/1 454 518 .. 1 85 [. 30.0 4.3e-08
CP000360_2891 1/1 473 539 .. 1 87 [] 27.6 2e-07

Alignments of top-scoring domains:
CP000360_4054: domain 1 of 1, from 585 to 650: score 99.0, E = 1.2e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+flan+sHE+RTP++aI+g+++l+l+ t+ls++q
CP000360_4 585 TKSDFLANMSHEIRTPMNAIIGMSHLALK---------TNLSPQQ-- 620

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+yl++i+ ++++ll ind+Ld+s+ieag
CP000360_4 621 ----------RDYLNKIQISSHHLLGVINDILDFSKIEAG 650

CP000360_2408: domain 1 of 1, from 222 to 290: score 97.2, E = 3.9e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++fl+n+sHE+RTPL++I+ +++lLl+++d ++l++eq
CP000360_2 222 LKTRFLSNMSHEFRTPLNSIISLSQLLLDRVD------GDLGSEQ-- 260

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + i+r+a+ ll+L+ndlLdl++ieag
CP000360_2 261 ----------EKQVTYIRRSADTLLELVNDLLDLAKIEAG 290

CP000360_2985: domain 1 of 1, from 347 to 413: score 93.0, E = 6.1e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+an+sHELRTPLt+I+gyae+L e + + ++ +
CP000360_2 347 TRRDFIANVSHELRTPLTSIQGYAETLSE---------AFREDDPA- 383

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re++e+i+r a+r+ rL +dlL+l+r e+g
CP000360_2 384 ----------REFVEIIRRNAQRMYRLTEDLLTLARVESG 413

CP000360_3499: domain 1 of 1, from 796 to 864: score 88.0, E = 1.6e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+ef++ +sHELRTPLt+Irg + lL ++ +++e++
CP000360_3 796 MKNEFISVVSHELRTPLTSIRGSLGLLAGGA-------LRKDPEKA- 834

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++l+++l+ +erl rLind+Ld+++ie+g
CP000360_3 835 ----------DRMLDIALKNTERLVRLINDILDIEKIESG 864

CP000360_2493: domain 1 of 1, from 801 to 866: score 69.5, E = 2.8e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++++++HEL++PLtaI gya+lL+ ++ls+
CP000360_2 801 AVGQLISGVAHELNNPLTAIVGYAQLLEQ---------EPLSARS-- 836

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++++++++++r +r +++lL ++r + +
CP000360_2 837 ----------LDFVQKLYKQTQRTRRVVQNLLSFARQRKP 866

CP000360_1772: domain 1 of 1, from 1027 to 1093: score 68.5, E = 5.3e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++++++HE ++PLtaI+gya+lL +++ +++
CP000360_1 1027 AVGQLVSGVAHEVNNPLTAIMGYADLLTS--------SPDIPPDA-- 1063

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ l +il+ea+r +++++lL ++r +
CP000360_1 1064 ----------RRDLGIILQEAQRTKQIVQNLLSFARQSVP 1093

CP000360_1386: domain 1 of 1, from 317 to 383: score 68.4, E = 5.5e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++a+++HE+R+PLt+I g +++L ++l+eeq
CP000360_1 317 AVGRMAAGIAHEIRNPLTSIAGSTKMLAS--------MSDLNEEQ-- 353

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + +++ re++rl+++i d+L ++r
CP000360_1 354 ----------QTLANIVTRESDRLNSIITDFLFYARDKKF 383

CP000360_0310: domain 2 of 2, from 240 to 306: score 68.1, E = 7e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++f+a++sHELRTPL+ Ir+ ael+l+ +++ee+
CP000360_0 240 RTRQFTADASHELRTPLSLIRTEAELALR---------KTRTEEE-- 275

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yr +l +l e+er +Li+ lL+l+r ++g
CP000360_0 276 ---------YRNALGHVLAESERTTELIESLLTLARTDSG 306

CP000360_2395: domain 1 of 2, from 367 to 435: score 67.2, E = 1.3e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+ f +n+sHE+RTPLt ++g +e Ll +++ + +e
CP000360_2 367 AKTTFYSNVSHEFRTPLTLMLGPLEELLGKSE------RAIRPEN-- 405

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++e+++r + rll+L+n lLd+srieag
CP000360_2 406 ----------HHLVEVAYRNGTRLLKLVNTLLDFSRIEAG 435

CP000360_4191: domain 1 of 1, from 454 to 519: score 67.2, E = 1.3e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++++++HEL++PLta++gy+el+ + +l +e
CP000360_4 454 GIGQLVSGVAHELNNPLTAVLGYTELMGD---------YNLQPEV-- 489

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l +++rea+r+ r+i++lL +sr
CP000360_4 490 ----------ARDLTIVRREANRMKRIIENLLRFSRQSRS 519

CP000360_4456: domain 1 of 1, from 215 to 279: score 62.5, E = 2.6e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++l+++sHELR PL+ + ++ l+++ ++ e+
CP000360_4 215 TQRRLLSDISHELRSPLARLNVAVGLARR----------QADVET-- 249

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++le+i+ ea+rl++++++lL+lsr+e+g
CP000360_4 250 ----------QKALERIEIEADRLNDMLQNLLTLSRLESG 279

CP000360_4452: domain 1 of 1, from 376 to 442: score 59.6, E = 1.8e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++++la+++HE+++PLtaI+gy++lL + l++++
CP000360_4 376 SMGRLLAGAAHEINNPLTAILGYSDLLTS--------SISLDPQT-- 412

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r + e+i ++a+r L++dlL +s+
CP000360_4 413 ----------RSMAEKIGQQARRTKTLVEDLLKFSQETPT 442

CP000360_3058: domain 1 of 1, from 414 to 481: score 59.2, E = 2.3e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ef+a++sHELRTPL++I +a+ L + + + +q+l
CP000360_3 414 LQMEFVATVSHELRTPLAVICSAADNLSD---------GVVNGQQQL 451

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++y e i+ ++++l +L++++L ++ ++g
CP000360_3 452 ----------QRYGEMIKVQGRQLIALVEQILLFAATREG 481

CP000360_3353: domain 1 of 1, from 745 to 811: score 57.2, E = 8.5e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++HE +TPL++I+ ya++L + + +++e r
CP000360_3 745 SIGLLAAGVAHEVNTPLAVISSYAQMLSK---------QLQGDERR- 781

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+le+i ++ r ++++n+lL +sr ++
CP000360_3 782 ----------SALLEKITTQTFRASEIVNNLLNFSRTGSS 811

CP000360_4050: domain 1 of 1, from 356 to 422: score 57.2, E = 8.6e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++ ++sH+LR PLta++++ae L e ++l+ qr
CP000360_4 356 TIGRMAGSISHDLRHPLTAVLANAEFLAE---------ANLNTTQR- 392

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+ i+ +++rl +L++ lL+lsr +
CP000360_4 393 ----------EELYMEIRVAVNRLTDLVDSLLELSRPAQA 422

CP000360_3840: domain 1 of 1, from 229 to 289: score 56.3, E = 1.5e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++++l ++sHELR PLt +r ++el++ ++
CP000360_3 229 SQRQMLGDISHELRSPLTRLRVALELAEG---------GD------- 259

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+ +++ +++ l++Li+++L+l r++ag
CP000360_3 260 ----------AEAMKRMNADLQKLEQLIEQVLTLNRLDAG 289

CP000360_4164: domain 1 of 1, from 74 to 132: score 54.7, E = 4.2e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + f+ ++ HEL+TP+t+Ir+y+e+L++ +ee+r
CP000360_4 74 QHDSFINAVTHELKTPITSIRLYLETLKK---------RSVDEEKR- 110

peLRledpeyreyletilreaerllrLindlL<-*
+++ +++l++++rllr ++++L
CP000360_4 111 ----------KQFYDIMLDDTDRLLRTVEQVL 132

CP000360_0474: domain 1 of 1, from 532 to 597: score 53.6, E = 8.7e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++e l + HELRTPL aI+g+ae++ + +
CP000360_0 532 AREEALGFVTHELRTPLVAIQGFAEMMTR---------MPNAKAS-- 567

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ +tilre++rll+Lin Ld r +ag
CP000360_0 568 ----------AQAPKTILRESRRLLALINSYLDVLRTDAG 597

CP000360_3271: domain 1 of 1, from 396 to 463: score 52.8, E = 1.5e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++++++HE ++P++aI ++e+L+++l +e ++
CP000360_3 396 AIGRLTSGVAHEVKNPINAIVVHLEILKNKL-------QEVAPDA-- 433

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ ++i++e++rl+r ++ l d++r +
CP000360_3 434 ----------RRHMDIIENEIRRLDRVVQTLVDFTRPVEL 463

CP000360_1587: domain 1 of 1, from 229 to 293: score 52.7, E = 1.6e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++e+ a+++HE+++ L++I+gya++L+ e +e
CP000360_1 229 SLGEMSAGIAHEFKNSLATISGYAQMLKG----------EPDETV-- 263

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+ +i+ +e l + + d+L ++r ++
CP000360_1 264 ----------SEFATRIQGTTENLTSVVTDFLNFARPQQL 293

CP000360_2599: domain 1 of 1, from 329 to 403: score 52.3, E = 2.1e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++a ++HE+++PL++I++y++l +++ +k + ++e ++
CP000360_2 329 TIGKMAAVVAHEINNPLSGILTYSKLVKRWIEK-----GIFDDEPKR 370

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e +e l+ + e++r+ +L+ +lL +sr
CP000360_2 371 HEM-------AENLDLVATESRRCGDLVKNLLSFSRTNPI 403

CP000360_3010: domain 1 of 1, from 759 to 825: score 50.9, E = 5.2e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++ +++H++++ Lt+Irgy+e+Ll +l++ +++
CP000360_3 759 AVGRLAGGVAHDFNNLLTVIRGYTEILLS----------DLPPGDVR 795

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r le i ++++r +L ++lL +sr +
CP000360_3 796 ----------RAELEEIMKASDRAGSLTRQLLAFSRQQVL 825

CP000360_0507: domain 1 of 1, from 253 to 320: score 50.1, E = 8.6e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+s +l ++ HE+RTPLt+I++ + +Lle + l + ++
CP000360_0 253 LRSALLDSVTHEFRTPLTSIKASVTTLLE---------GSLADAAAR 290

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+l +i +e++rl+rL+ + +++r+++
CP000360_0 291 ----------AELLTIINEETDRLNRLVGEAAEMARLDSR 320

CP000360_0750: domain 1 of 1, from 168 to 234: score 49.2, E = 1.6e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e++a+l+HE+R+PL++I g ++++ + +l+ e +
CP000360_0 168 TLGELAAGLAHEIRNPLAGIAGVIDIIGR----------DLPIESPA 204

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ +++ea +++r++ dlL+ +r ++
CP000360_0 205 ----------CAVVKEVKQEAMHINRILTDLLETARPKHP 234

CP000360_1808: domain 1 of 1, from 322 to 389: score 48.8, E = 2.1e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f ++sH+LR P I+g+++lLl+ + t+ +e +
CP000360_1 322 ELEAFSYSVSHDLRAPFRHISGFSDLLLR-------HLTNTDETT-- 359

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r y++ti ++a++ +L+++lL +sr+
CP000360_1 360 ----------RHYVRTIAESAQYAGALVDNLLAFSRMSRS 389

CP000360_4556: domain 1 of 1, from 212 to 274: score 47.8, E = 3.9e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +++la++sHELR PL+ + + ++l+++ +++r
CP000360_4 212 SGQRLLADISHELRSPLARLHFSVKLART-------------APDR- 244

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+l++++r+++rl L++ l +++r+e
CP000360_4 245 ----------DAALDRVKRDIDRLTTLVSSLVEIARAEGS 274

CP000360_3596: domain 1 of 1, from 393 to 459: score 46.9, E = 7e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + + +++H++++ Lt+Irgya + l+ +++++
CP000360_3 393 AIGTLSGGIAHDFNNLLTVIRGYARMVLD---------RVGNDPEL- 429

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +e i++++ r +L ++lL +sr +
CP000360_3 430 ----------RTDVEQIDEAGARAAALTSQLLAFSRRQML 459

CP000360_0520: domain 1 of 1, from 374 to 440: score 45.8, E = 1.5e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++++ +++H++++ +t I+gy el+l+ +++q+
CP000360_0 374 ALGRLAGGVAHDFNNLITIISGYGELALD---------KSSGDPQL- 410

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ i++++er L ++lL +sr +
CP000360_0 411 ----------TSFIQEIRKAGERATGLTRQLLAFSRKQVL 440

CP000360_3096: domain 1 of 1, from 255 to 320: score 42.7, E = 1.1e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ + +++H+++ P+t+Irg +e++l e s+ +
CP000360_3 255 QLRTVTGAVAHDMKSPVTSIRGKLEVALL----------EGSAAD-- 289

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+re + + + ++rl++ in Ldl+ +eag
CP000360_3 290 ---------WREPVAEAVEGLDRLSQFINTTLDLAEAEAG 320

CP000360_0936: domain 1 of 1, from 263 to 331: score 42.1, E = 1.6e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ f ++sH+LR PL ++ g++ ++ ++ els+
CP000360_0 263 DLEAFSYSVSHDLRGPLEVVNGMSYIIHLQYG------NELSPGL-- 301

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l++i+++++r+++Li+dlL l+r
CP000360_0 302 ----------KDCLDRIDDASKRMNELIEDLLNLARVTKS 331

CP000360_2550: domain 1 of 1, from 185 to 251: score 40.5, E = 4.6e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++ +++H++++ L +I++yaelL+e ++ ls
CP000360_2 185 AVGRLAGGVAHDFNNMLGVISAYAELLRE--------EPSLSLRA-- 221

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++ il++++r ++L ++lL +sr +
CP000360_2 222 ----------SKRVDEILSATQRANALTRQLLAFSRKQVI 251

CP000360_3232: domain 1 of 1, from 373 to 439: score 38.4, E = 1.8e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++++a+++H++++ L +++y++lL+e++ +++s+e++
CP000360_3 373 ALGRLAAGVAHDFNNVLMIVQAYSDLLKERFA------GDASAEKH- 412

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ i+ +++r +L +lL + r a
CP000360_3 413 -------------VTQIQGAVDRAAKLTAQLLAFGRGHAR 439

CP000360_2395: domain 2 of 2, from 911 to 977: score 38.1, E = 2.1e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++a+++HE+++PL aI ++ l+l ++l+e
CP000360_2 911 SVGRMAATIAHEINNPLEAITNTLFLALH--------AQDLPESA-- 947

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
reyle ++ e++r ++ ++ L + r +
CP000360_2 948 ----------REYLEMADGELRRVAHITRQALGFYRESNA 977

CP000360_3708: domain 1 of 1, from 626 to 696: score 37.2, E = 3.9e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e++a+l+HE ++PLtaI + +++l+ l+ ++l++e +
CP000360_3 626 TMGELTASLAHEVNQPLTAITNNGSACLR-----LLANQNLNPEVL- 666

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++le i +++r ++ i +++ + +
CP000360_3 667 ----------RQALEEIVADGRRASAVIARIRGFIKKAPA 696

CP000360_3711: domain 1 of 1, from 511 to 581: score 37.1, E = 4.2e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e++a+l+HE+++P++a ++ a ++ ++l+ + +++l+e q
CP000360_3 511 TMGELAASLAHEIKQPISAAMTDARTCSRWLN---QDYPDLPEAQ-- 552

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++++++ r +++i++++ l r +++
CP000360_3 553 -----------AAASRVIKDVARASEIISRVRSLFRKDSP 581

CP000360_0666: domain 1 of 1, from 459 to 525: score 36.3, E = 7.2e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++++ +++H++++ + I+ yae L+ +e +e+
CP000360_0 459 ALGRLAGGVAHDFNNLIMIISSYAERLQY--------FAENPEKV-- 495

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r e+il++++r +L ++lL +sr +
CP000360_0 496 ----------RSDSERILQASDRAAALTRELLAFSRKQIL 525

CP000360_1390: domain 1 of 1, from 516 to 590: score 36.2, E = 7.6e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +e ++ ++HE+++PLt I ++ae +++ ld+ l+ d++ +
CP000360_1 516 AWREVARRVAHEIKNPLTPIALAAERIRRHLDRGLQPDANSLAVI-- 560

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +ti +++e l++L++++ l+r a
CP000360_1 561 ----------HSCSDTIASSVETLRNLVDQFSALARFPAS 590

CP000360_1810: domain 1 of 1, from 142 to 208: score 34.3, E = 2.6e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++++a+++HE+++PL+++ + lL + +el+ +
CP000360_1 142 MLGRLAATVAHEINNPLSSVTNVLYLLST--------QPELTNDS-- 178

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r ++e ++ e++r ++ + L + r
CP000360_1 179 ----------RILIEMAQTELKRVAEISHQTLSFYRESPH 208

CP000360_2399: domain 1 of 1, from 484 to 548: score 33.9, E = 3.4e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++ +++HE ++P+ aI+ + lL++ + +++ q
CP000360_2 484 VAGRMAGTIAHEVNNPMEAIKNCIFLLQD---------AIRDDSQ-- 519

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++ e+er r+++++L l r ++
CP000360_2 520 -----------PVYQILKTETERVARIVRQMLGLYRNTEQ 548

CP000360_1777: domain 1 of 1, from 140 to 204: score 33.9, E = 3.5e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++ + +++H L++ Lt+++g+aelLl + ++ see
CP000360_1 140 MLGRYMLDMRHSLNNALTSVLGNAELLLL-------EPGNFSEEV-- 177

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ l ti+ + r+++++ ++ s +e++
CP000360_1 178 ----------RDQLATIRTMSLRMNEILARF---SSLETE 204

CP000360_0711: domain 1 of 1, from 135 to 194: score 33.7, E = 3.8e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++++ +l+HEL++PL+++ + ++lL +++ + +++++
CP000360_0 135 AKTRLINHLAHELNNPLAGLTFVIHLLGTRQ-------DVATDDT-- 172

peLRledpeyreyletilreaerllrLindlL<-*
+++l t+ + +er+++ ++ +L
CP000360_0 173 ----------KKLLGTASQLVERISATVQHVL 194

CP000360_3515: domain 1 of 1, from 759 to 825: score 32.9, E = 6.5e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++a+++HE+++PL a+ ++ l+++ t+ ++q+
CP000360_3 759 ATGRLAATIAHEINNPLEAVTNFIYLAKT---------TDGVSDQV- 795

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r yle++++e+ r +++ ++ L + r +g
CP000360_3 796 ----------RSYLEIADQELGRVSHIARQTLGFYRDSSG 825

CP000360_2777: domain 1 of 1, from 93 to 157: score 32.8, E = 7e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+ +++ +++HE+++PL +I+ ++e ++ ++++ +
CP000360_2 93 ALAQLALGAAHEINNPLLGILSHLEWEKK----------TADAAT-- 127

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e ++ ++ a+r+++ ++ lL ++r +
CP000360_2 128 ----------KEEIDQCIEGAKRISSAVRGLLNYARPGPL 157

CP000360_1729: domain 1 of 1, from 366 to 437: score 32.6, E = 8e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +e+++ l+HEL++PL +++++e + + e +e+
CP000360_1 366 AWRELARRLAHELKNPLFPLQLTVENMVK--------AREVMPEE-- 402

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+d ++e t+ e++ l +i+++ d+s++ ++
CP000360_1 403 -----FDEIFHESATTLMAEIQNLKGIIQRFSDFSKMPQP 437

CP000360_3014: domain 1 of 1, from 143 to 209: score 32.3, E = 9.4e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++ +++H++++ L +I y+el+l+ + ++ + +
CP000360_3 143 AIGRLAGGVAHDFNNLLMVITSYTELMLD---------SMADFDPL- 179

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ + +l+++ r +L ++lL +sr +
CP000360_3 180 ----------RKKAQEVLKASARAASLTRQLLAFSRKQVL 209

CP000360_0843: domain 1 of 1, from 486 to 556: score 31.7, E = 1.4e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ ++a+++HE ++PL++I+++a+++l+ ++ ++ + e +
CP000360_0 486 SLGVLTASIAHEVNQPLSGIITNASTCLR-----MLSAEPPNVEGA- 526

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re + +r+++r + i++l++l
CP000360_0 527 ----------RETALRTIRDGNRAADVISRLRTLFTRKDR 556

CP000360_2407: domain 1 of 1, from 272 to 338: score 31.1, E = 2.2e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++a+++HE+++PL aI ++ l+ ++ l+ ++
CP000360_2 272 STGRMAATIAHEINNPLEAITNLVYLISV--------SPSLDNDT-- 308

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+y++ ++ e+ r ++ + L + r ++
CP000360_2 309 ----------RRYVDMAQAELSRVTHISKQTLGFYRQSSN 338

CP000360_0933: domain 1 of 1, from 454 to 518: score 30.0, E = 4.3e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ ++ +++H++++ Lt+I gy+ + ++l +++++
CP000360_0 454 SLGTMAGGVAHDFNNLLTVIGGYSAMQMANL--------DANDPN-- 490

peLRledpeyreyletilreaerllrLindlLdlsrie<-*
+ey i+ +++r L ++lL +sr +
CP000360_0 491 ----------HEYATEIKAASDRAAGLTRQLLAFSRQQ 518

CP000360_2891: domain 1 of 1, from 473 to 539: score 27.6, E = 2e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++a+++HE+++PL +I ++ l+++ ++el+
CP000360_2 473 AAGRLAATVAHEINNPLESITNLVYLAKT--------SPELPTSL-- 509

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+yle +++e+ r + ++ L + r +
CP000360_2 510 ----------MQYLEQADQELSRVAYIARQTLGFYRDNSR 539


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-14 5 0|=
-13 44 3|*==
-12 199 109|======*=====
-11 455 566|=========================== *
-10 810 1050|================================================ *
-9 955 1084|========================================================= *
-8 848 812|===============================================*==
-7 591 511|==============================*====
-6 347 294|=================*===
-5 211 161|=========*===
-4 107 86|=====*=
-3 60 45|==*=
-2 42 23|=*=
-1 18 12|*=
0 13 6|*
1 5 3|*
2 7 1|*
3 3 0|=
4 0 0|
5 1 0|=
6 0 0|
7 1 0|=
8 0 0|
9 1 0|=
> 10 54 -|====


% Statistical details of theoretical EVD fit:
mu = -8.9758
lambda = 0.6525
chi-sq statistic = 236.2824
P(chi-square) = 1.857e-313

Total sequences searched: 4777

Whole sequence top hits:
tophits_s report:
Total hits: 48
Satisfying E cutoff: 48
Total memory: 22K

Domain top hits:
tophits_s report:
Total hits: 49
Satisfying E cutoff: 49
Total memory: 40K


Acknowledgements:

This research is funded by:

Developed by: