Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
3 projects found  

1 accessions found for Candidatus Koribacter versatilis Ellin345  

Data for CP000360  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000360.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000360_4284 CDS_5096984-5098642 56.8 2.2e-16 1
CP000360_2438 CDS_2886164-2889256 55.5 5.3e-16 1
CP000360_3744 CDS_4421992-4425048 50.1 2.1e-14 1
CP000360_4058 CDS_4808229-4808978 47.0 1.7e-13 1
CP000360_1688 CDS_2053697-2052366 44.8 7.4e-13 1
CP000360_3083 CDS_3668121-3667183 41.7 6.3e-12 1
CP000360_0971 CDS_1234926-1233148 40.6 1.3e-11 1
CP000360_0821 CDS_1020221-1018800 36.3 2.5e-10 1
CP000360_1450 CDS_1755332-1753311 36.3 2.5e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000360_4284 1/1 325 390 .. 1 70 [] 56.8 2.2e-16
CP000360_2438 1/1 799 866 .. 1 70 [] 55.5 5.3e-16
CP000360_3744 1/1 792 858 .. 1 70 [] 50.1 2.1e-14
CP000360_4058 1/1 52 119 .. 1 70 [] 47.0 1.7e-13
CP000360_1688 1/1 249 310 .. 6 70 .] 44.8 7.4e-13
CP000360_3083 1/1 111 178 .. 1 70 [] 41.7 6.3e-12
CP000360_0971 1/1 383 450 .. 1 70 [] 40.6 1.3e-11
CP000360_0821 1/1 271 334 .. 1 70 [] 36.3 2.5e-10
CP000360_1450 1/1 475 542 .. 1 70 [] 36.3 2.5e-10

Alignments of top-scoring domains:
CP000360_4284: domain 1 of 1, from 325 to 390: score 56.8, E = 2.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI+RELHD+ gQ+L +i+l l+++++ + ++ a++ ++e
CP000360_4 325 ERKRISRELHDETGQALMVIRLYLGMLEATV--TTR--TAKTKIHET 367

relarealaevRrllgdLRpaal<-*
e ++++++ +Rr++g+L p +l
CP000360_4 368 LEVVDRTIEGIRRIIGRLSPLVL 390

CP000360_2438: domain 1 of 1, from 799 to 866: score 55.5, E = 5.3e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD++ Q+L +++ q +++r ll ++ pe a + ld +
CP000360_2 799 ERTRIARELHDTLLQTLHGLMFQFQAVRNLL--PRRPEDAMRSLDDA 843

relarealaevRrllgdLRpaal<-*
++alae R++++++R
CP000360_2 844 IVETEKALAEGRNAIQGIRSESR 866

CP000360_3744: domain 1 of 1, from 792 to 858: score 50.1, E = 2.1e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD+ Q+L + k+ +e+a+ ++dp + r a++++
CP000360_3 792 ERTRLARELHDTFLQTLQGSKMVAEVAL-NG--PADPVRMRNAIQRV 835

relarealaevRrllgdLRpaal<-*
e +++a+ e R++l+ LR ++
CP000360_3 836 LEWLDKAIHEGRAALHSLRSSTV 858

CP000360_4058: domain 1 of 1, from 52 to 119: score 47.0, E = 1.7e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD +Q+L+++++qle++++ l + + +r+al +
CP000360_4 52 ERSYLARELHDDTSQRLALLAIQLEALAMNL--PQKKATLRAALMDM 96

relarealaevRrllgdLRpaal<-*
++ + + a++ +l ++L+p++l
CP000360_4 97 HKSVTDLAADIHALSRQLHPSVL 119

CP000360_1688: domain 1 of 1, from 249 to 310: score 44.8, E = 7.4e-13
*->ARELHDsvgQsLsaiklqlelarrlldsdkdpe..earealdeirel
+RELHD+ gQ L+ai l++a+ + +p+++ ++ l+e+re+
CP000360_1 249 SRELHDEFGQILTAIGSLLGRAE-----KQAPAgsTWARDLHEVREM 290

arealaevRrllgdLRpaal<-*
a+ +l+ vR l ++L+p +l
CP000360_1 291 AQSTLDSVRSLSQALHPVVL 310

CP000360_3083: domain 1 of 1, from 111 to 178: score 41.7, E = 6.3e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD ++QsL ++ q+e+a + + +p++ + ++
CP000360_3 111 ERARIARELHDDISQSLMILTFQMERAGKPV--SNEPGKRHPDAPAL 155

relarealaevRrllgdLRpaal<-*
++ +re + + ++++L+ + l
CP000360_3 156 ADDLREVVRRISKMAHELHSSSL 178

CP000360_0971: domain 1 of 1, from 383 to 450: score 40.6, E = 1.3e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR ARELHD+ QsL a+ +q++++rr+ + ++++++l+++
CP000360_0 383 ERARVARELHDGAIQSLIAVEMQVDVIRRQS--VGESARLAAELARV 427

relarealaevRrllgdLRpaal<-*
++l+++ +R+l ++++p +
CP000360_0 428 QHLLQQEVINLRELMQQMKPVDM 450

CP000360_0821: domain 1 of 1, from 271 to 334: score 36.3, E = 2.5e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD ++Q+L+++++ l++ + + + e++ +l+
CP000360_0 271 ERARIARELHDDISQRLAVLAIDLDGREGVP--Q----EVQSHLEKF 311

relarealaevRrllgdLRpaal<-*
r + e ++v l ++L+ + l
CP000360_0 312 RLQVVEIANDVHGLSHELHSSKL 334

CP000360_1450: domain 1 of 1, from 475 to 542: score 36.3, E = 2.5e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E aRIARELHD + Q+++++ +q++ + ++ p e++e+++++
CP000360_1 475 ECARIARELHDDINQRIALLVIQMQCMADGS--TETPSELQEHIRQL 519

relarealaevRrllgdLRpaal<-*
a e +v +l ++L+ + l
CP000360_1 520 SLQATEISHDVQALSHRLHSSKL 542


Histogram of all scores:
score obs exp (one = represents 16 sequences)
----- --- ---
-14 8 0|=
-13 64 0|====
-12 120 53|===*====
-11 242 437|================ *
-10 661 1015|========================================== *
-9 905 1153|========================================================= *
-8 767 889|================================================ *
-7 611 558|==================================*====
-6 461 316|===================*=========
-5 436 169|==========*=================
-4 196 88|=====*=======
-3 101 45|==*====
-2 80 23|=*===
-1 55 11|*===
0 23 6|*=
1 13 3|*
2 12 1|*
3 6 0|=
4 2 0|=
5 3 0|=
> 6 11 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1395.0372
P(chi-square) = 0

Total sequences searched: 4777

Whole sequence top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: