Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

5 accessions found for Roseobacter denitrificans OCh 114  

Data for CP000362  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000362.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000362_2606 CDS_2678435-2679868 71.1 1.1e-20 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000362_2606 1/1 259 326 .. 1 70 [] 71.1 1.1e-20

Alignments of top-scoring domains:
CP000362_2606: domain 1 of 1, from 259 to 326: score 71.1, E = 1.1e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R ARELHD+++Q L +++ l++arr l ++ ++ a+e l
CP000362_2 259 ERGRVARELHDGISQILVGVRYALDTARRKL--ERGDPTAAEPLGKG 303

relarealaevRrllgdLRpaal<-*
e++ ea++evRr+ +dLRp+ l
CP000362_2 304 IETLGEAISEVRRISRDLRPGML 326


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 30 0|===
-13 79 0|=======
-12 104 44|===*====
-11 183 361|=============== *
-10 510 839|======================================== *
-9 733 952|========================================================= *
-8 620 734|================================================ *
-7 546 461|===================================*======
-6 379 261|====================*=========
-5 327 140|==========*===============
-4 178 73|=====*========
-3 112 37|==*======
-2 56 19|=*===
-1 30 9|*==
0 17 4|*=
1 18 2|*=
2 7 1|*
3 7 0|=
4 3 0|=
5 3 0|=
6 2 0|=
7 0 0|
> 8 2 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1094.1189
P(chi-square) = 0

Total sequences searched: 3960

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: