hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000377.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000377_0877 CDS_936440-935016 62.0 4.1e-18 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000377_0877 1/1 257 325 .. 1 70 [] 62.0 4.1e-18
Alignments of top-scoring domains:
CP000377_0877: domain 1 of 1, from 257 to 325: score 62.0, E = 4.1e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R ARELHDs++Q L +++ le++rr++ + + e ++ ld
CP000377_0 257 ERGRVARELHDSISQLLVGVRYALETVRRRIG-RGEFETTAAPLDKG 302
relarealaevRrllgdLRpaal<-*
e + +a++evRr+ +dLRp++l
CP000377_0 303 VEGLATAITEVRRISRDLRPGVL 325
Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 3 0|=
-13 27 0|===
-12 73 33|===*====
-11 114 277|============ *
-10 362 644|===================================== *
-9 543 731|======================================================= *
-8 474 563|================================================ *
-7 445 354|===================================*=========
-6 316 200|===================*============
-5 302 107|==========*====================
-4 138 56|=====*========
-3 91 28|==*=======
-2 53 14|=*====
-1 33 7|*===
0 21 3|*==
1 12 1|*=
2 5 0|=
3 6 0|=
4 4 0|=
5 3 0|=
6 1 0|=
7 1 0|=
8 1 0|=
> 9 2 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1207.0012
P(chi-square) = 0
Total sequences searched: 3030
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K