Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Pseudoalteromonas atlantica T6c  

Data for CP000388  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000388.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000388_2275 CDS_2793927-2792533 54.6 8.7e-16 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000388_2275 1/1 251 318 .. 1 70 [] 54.6 8.7e-16

Alignments of top-scoring domains:
CP000388_2275: domain 1 of 1, from 251 to 318: score 54.6, E = 8.7e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER++I+RELHD++ Q L +ik le+ l +++ + l+ +
CP000388_2 251 ERRHISRELHDGIVQVLVSIKYSLEATGLWL--KRAKVDKPQPLEHA 295

relarealaevRrllgdLRpaal<-*
+ +++a++e+Rr+ ++L+p +l
CP000388_2 296 QSNLQDAISEIRRISHHLHPRIL 318


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-14 16 0|=
-13 108 0|=======
-12 177 47|==*========
-11 302 392|================== *
-10 761 910|============================================= *
-9 953 1033|========================================================= *
-8 675 796|======================================== *
-7 482 500|=============================*
-6 326 283|================*===
-5 224 152|========*=====
-4 122 79|====*===
-3 54 40|==*=
-2 35 20|=*=
-1 26 10|*=
0 9 5|*
1 6 2|*
2 1 1|*
3 2 0|=
4 0 0|
> 5 2 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 521.7769
P(chi-square) = 0

Total sequences searched: 4281

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: