Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

4 accessions found for Chelativorans sp. BNC1  

Data for CP000390  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000390.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000390_0615 CDS_696951-699128 135.2 6.7e-46 1
CP000390_1932 CDS_2083487-2085010 122.9 1.1e-41 1
CP000390_3895 CDS_4235603-4237342 109.6 3.6e-37 1
CP000390_1474 CDS_1580950-1579775 90.4 1.3e-30 1
CP000390_0180 CDS_224974-226116 83.1 3.9e-28 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000390_0615 1/1 534 616 .. 1 85 [] 135.2 6.7e-46
CP000390_1932 1/1 283 364 .. 1 85 [] 122.9 1.1e-41
CP000390_3895 1/1 383 465 .. 1 85 [] 109.6 3.6e-37
CP000390_1474 1/1 197 285 .. 1 85 [] 90.4 1.3e-30
CP000390_0180 1/1 169 250 .. 1 85 [] 83.1 3.9e-28

Alignments of top-scoring domains:
CP000390_0615: domain 1 of 1, from 534 to 616: score 135.2, E = 6.7e-46
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQS+a QT+R+ ++l +f+++F+ RL AL+ aHdL
CP000390_0 534 ELNHRVKNTLATVQSLASQTARHCEDLGDFRGRFEERLLALAHAHDL 580

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt ++W+ A L L+ + L P +ge+++Ri ++GP+
CP000390_0 581 --LTKRHWENAPLESLAHEVLTPLAGEASDRILIEGPA 616

CP000390_1932: domain 1 of 1, from 283 to 364: score 122.9, E = 1.1e-41
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtL++VQ+ia QTlR+ +s+++f+++F +RL +L+raH+L
CP000390_1 283 ELNHRVKNTLSTVQAIASQTLRHMESPEDFKASFMARLESLARAHSL 329

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++++W+gA L +L++ + + e ++ + +sGP+
CP000390_1 330 --LSEANWEGAYLTKLVQDQQQLNLIE-EDKFAVSGPE 364

CP000390_3895: domain 1 of 1, from 383 to 465: score 109.6, E = 3.6e-37
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+ HR KN+L+vV+S+a QT+R+++sl+ f+++F RL L+r+ dL
CP000390_3 383 EVAHRAKNQLTVVSSMAKQTARSSRSLPVFLDSFQKRLYGLARSTDL 429

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + g++LreLl a+++P+++ed R+ +sGP+
CP000390_3 430 --LIAGGATGVELRELLMAQIEPFRPEDMKRLDISGPP 465

CP000390_1474: domain 1 of 1, from 197 to 285: score 90.4, E = 1.3e-30
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN++A+ S++r T+R++ +++e++ a+sgRL+ALs+aH+L
CP000390_1 197 EMDHRIKNLFAIAESMIRTTARSTSTKEEMALALSGRLHALSAAHSL 243

V.p.Lt..rseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
V++++ ++++ + +L+e++ ++P++++ + R++l+GP+
CP000390_1 244 VrRkVRhnEEGLRTTELGEIIDTIIRPHAPDLSARFQLEGPQ 285

CP000390_0180: domain 1 of 1, from 169 to 250: score 83.1, E = 3.9e-28
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KN+LA+V+++a QTl++aas++e+++++ +RL L++aH++
CP000390_0 169 ELSHRMKNLLAMVSGLAGQTLQFAASKEEAHRTLVQRLSVLAEAHSV 215

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+ + + + A +r+++e++L+P+++ +++Ri ++G +
CP000390_0 216 --FMEGRRSRAPMRAVIERALSPFRS-GRGRISIDGAP 250


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 6 0|=
-13 39 0|===
-12 304 0|========================
-11 369 33|==*==========================
-10 604 420|================================*==============
-9 716 1040|======================================================== *
-8 757 1079|==========================================================*
-7 507 725|======================================= *
-6 310 395|======================== *
-5 198 196|===============*
-4 114 92|=======*=
-3 70 43|===*==
-2 26 19|=*
-1 16 9|*=
0 11 4|*
1 9 1|*
> 2 8 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 3785.8215
P(chi-square) = 0

Total sequences searched: 4064

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: