hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000394.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000394_1133 CDS_1258228-1261674 78.6 7.6e-27 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000394_1133 1/1 961 1042 .. 1 85 [] 78.6 7.6e-27
Alignments of top-scoring domains:
CP000394_1133: domain 1 of 1, from 961 to 1042: score 78.6, E = 7.6e-27
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+nHRVKN++Av+ +i++ +R+++ ++ f++++++R+++L++aH+L
CP000394_1 961 EMNHRVKNLFAVIAGIVTAVSRGHDNVPTFARDIRDRIASLGNAHSL 1007
VpLtrseWa..gAdLreLleaeLaPyggedaeRitlsGPd<-*
s ++++ dL eL+e +LaPy+ ++ i + GP+
CP000394_1 1008 ---AASGGEpkAIDLQELVEVTLAPYRH--DTKIDIYGPS 1042
Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-16 2 0|=
-15 0 0|
-14 14 0|==
-13 40 0|=====
-12 163 0|=====================
-11 223 19|==*=========================
-10 351 252|===============================*============
-9 388 623|================================================= *
-8 429 647|====================================================== *
-7 326 435|========================================= *
-6 190 237|======================== *
-5 135 117|==============*==
-4 72 55|======*==
-3 53 25|===*===
-2 22 11|=*=
-1 18 5|*==
0 4 2|*
> 1 7 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2382.4553
P(chi-square) = 0
Total sequences searched: 2437
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K