Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

4 accessions found for Rhodococcus jostii RHA1  

Data for CP000431  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000431.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000431_0160 CDS_220439-219270 90.8 3.1e-26 1
CP000431_6416 CDS_6972579-6973775 82.3 1e-23 1
CP000431_3931 CDS_4175544-4174072 78.4 1.4e-22 1
CP000431_6002 CDS_6521185-6522525 62.9 5.2e-18 1
CP000431_6032 CDS_6554494-6555696 62.5 7e-18 1
CP000431_5216 CDS_5616277-5617779 58.5 1e-16 1
CP000431_2226 CDS_2384246-2385892 53.0 4.3e-15 1
CP000431_4156 CDS_4409082-4411025 52.4 6.5e-15 1
CP000431_0049 CDS_55092-56813 42.8 4.5e-12 1
CP000431_2592 CDS_2782486-2780774 42.2 6.8e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000431_0160 1/1 187 254 .. 1 70 [] 90.8 3.1e-26
CP000431_6416 1/1 191 258 .. 1 70 [] 82.3 1e-23
CP000431_3931 1/1 291 356 .. 1 70 [] 78.4 1.4e-22
CP000431_6002 1/1 233 298 .. 1 70 [] 62.9 5.2e-18
CP000431_6032 1/1 194 265 .. 1 70 [] 62.5 7e-18
CP000431_5216 1/1 285 349 .. 1 65 [. 58.5 1e-16
CP000431_2226 1/1 355 421 .. 1 70 [] 53.0 4.3e-15
CP000431_4156 1/1 452 519 .. 1 70 [] 52.4 6.5e-15
CP000431_0049 1/1 382 440 .. 1 70 [] 42.8 4.5e-12
CP000431_2592 1/1 379 446 .. 1 70 [] 42.2 6.8e-12

Alignments of top-scoring domains:
CP000431_0160: domain 1 of 1, from 187 to 254: score 90.8, E = 3.1e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v+++ s++++q+++a ++l +++p+ a++al++i
CP000431_0 187 ERTRIARELHDVVAHAVSVMIVQADGASYAL--KTNPDIAKQALTNI 231

relarealaevRrllgdLRpaal<-*
+ ++realae+Rr+++ LR+
CP000431_0 232 ASTGREALAELRRTVSLLRTEPA 254

CP000431_6416: domain 1 of 1, from 191 to 258: score 82.3, E = 1e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E aRIAR+LHD+v++++s++ +q++ a +++ ++ +e r++++ i
CP000431_6 191 EKARIARDLHDVVAHHMSMVVVQAQSAPYRI--ADMSDETRAEFESI 235

relarealaevRrllgdLRpaal<-*
+++r al+evR llg+LR ++
CP000431_6 236 GAAGRAALNEVRGLLGVLRSDGQ 258

CP000431_3931: domain 1 of 1, from 291 to 356: score 78.4, E = 1.4e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+v+Q Ls+i + l++a+r++ +++ +ar++++ +
CP000431_3 291 ERERLAREIHDTVAQDLSSIQMLLHAAERAA--PDH--PARDRIRLA 333

relarealaevRrllgdLRpaal<-*
re+a ++lae+R+l+gdL pa+l
CP000431_3 334 RETAADSLAETRQLIGDLTPAVL 356

CP000431_6002: domain 1 of 1, from 233 to 298: score 62.9, E = 5.2e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHDsv Q+ ++ +q+e++r + ++d e e+ld +
CP000431_6 233 ERHRIARELHDSVTQAVLSAGMQIEVCRSGV--PDD--ERSERLDLA 275

relarealaevRrllgdLRpaal<-*
+el r+a +++R ++ +L +++
CP000431_6 276 KELTRRAVEQLRSAIYALNHSGG 298

CP000431_6032: domain 1 of 1, from 194 to 265: score 62.5, E = 7e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe....earea
ER+R+ARE+HD+v Q+L++ l le+a+++ + ++++++++are
CP000431_6 194 ERERLAREIHDTVTQGLTSSLLRLEAAEQIW--AQADPrteeRARED 238

ldeirelarealaevRrllgdLRpaal<-*
++ + +++re lae+R l+++L + l
CP000431_6 239 VRVATGTLRENLAETRSLVHHLAAPNL 265

CP000431_5216: domain 1 of 1, from 285 to 349: score 58.5, E = 1e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE HD++++sLs l+l +arr+l++d+d + a +al +
CP000431_5 285 ERQRIAREVHDVIAHSLSITLLHLTAARRALEQDRDVDDAVDALSDA 331

relarealaevRrllgdL<-*
++l+r+a+a++Rr++g L
CP000431_5 332 ERLGRQAMADIRRTVGLL 349

CP000431_2226: domain 1 of 1, from 355 to 421: score 53.0, E = 4.3e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a + l+ +++ + p+ +r ++++
CP000431_2 355 DRDRIARDLHDNVIQRLFATGMSLQSTHAVG---DVPDGVRSIVATA 398

relarealaevRrllgdLRpaal<-*
e ++++ +e+R ++ dL+ ++
CP000431_2 399 VEQLDRTVREIRTTIFDLQATGI 421

CP000431_4156: domain 1 of 1, from 452 to 519: score 52.4, E = 6.5e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ I RELHD++g sL++i+l+l++ar ll +dp +a+e +d++
CP000431_4 452 ERQTIRRELHDGLGPSLAGIRLGLQGARNLL--GSDPVAAAELIDAL 496

relarealaevRrllgdLRpaal<-*
+e +++ + vR+l + + p++l
CP000431_4 497 QEQLDHQVEGVRQLSRSMFPPVL 519

CP000431_0049: domain 1 of 1, from 382 to 440: score 42.8, E = 4.5e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a+ l l+ r+ + +
CP000431_0 382 DRDRIARDLHDHVIQRLFAVGLSLQST-----------LQRAKAPIV 417

relarealaevRrllgdLRpaal<-*
++ ++++++++ ++++d+R+a++
CP000431_0 418 KQRLEQSIDDLHDIVRDIRTAIF 440

CP000431_2592: domain 1 of 1, from 379 to 446: score 42.2, E = 6.8e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
R+R+ R+LHD+ Q+L ++ l + +a++ + ++e +re+l
CP000431_2 379 ARRRLERDLHDGAQQRLVSLGLEVRMAEASV----PAEwvDVREQLS 421

eirelarealaevRrllgdLRpaal<-*
+i+ + +++R+l ++++pa+l
CP000431_2 422 AIASGLTGVSEDLRELSHGIHPAIL 446


Histogram of all scores:
score obs exp (one = represents 21 sequences)
----- --- ---
-14 6 0|=
-13 64 1|*===
-12 135 80|===*===
-11 237 660|============ *
-10 801 1533|======================================= *
-9 1226 1741|==========================================================*
-8 1079 1342|==================================================== *
-7 1022 843|========================================*========
-6 809 477|======================*================
-5 771 256|============*========================
-4 401 133|======*=============
-3 248 68|===*========
-2 155 35|=*======
-1 114 17|*=====
0 48 9|*==
1 29 4|*=
2 23 2|*=
3 11 1|*
4 5 0|=
5 6 0|=
6 3 0|=
7 2 0|=
> 8 16 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 4258.4927
P(chi-square) = 0

Total sequences searched: 7211

Whole sequence top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: