hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000448.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000448_0178 CDS_229071-230258 66.8 1.3e-19 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000448_0178 1/1 190 257 .. 1 70 [] 66.8 1.3e-19
Alignments of top-scoring domains:
CP000448_0178: domain 1 of 1, from 190 to 257: score 66.8, E = 1.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHD+ +Q+L ++ + l+l+++l ++ e++ +++ +i
CP000448_0 190 ERRKIARELHDGPAQNLVSMLIRLDLIAQLG--YEEKERISDEINNI 234
relarealaevRrllgdLRpaal<-*
+++are+la++R + dL+p
CP000448_0 235 KDMARESLADIRSIMFDLKPLLV 257
Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-14 16 0|==
-13 48 0|======
-12 75 27|==*======
-11 174 229|==================== *
-10 440 532|================================================= *
-9 506 604|========================================================= *
-8 378 466|========================================== *
-7 331 293|================================*====
-6 203 165|==================*====
-5 157 88|=========*========
-4 74 46|=====*===
-3 47 23|==*===
-2 19 12|=*=
-1 13 6|*=
0 7 3|*
1 5 1|*
2 5 0|=
3 1 0|=
4 2 0|=
5 0 0|
6 1 0|=
> 7 2 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 256.6230
P(chi-square) = 0
Total sequences searched: 2504
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K