Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Alkalilimnicola ehrlichii MLHE-1  

Data for CP000453  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000453.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000453_0999 CDS_1144073-1146007 68.0 6.5e-20 1
CP000453_2704 CDS_3087419-3088879 53.5 1.2e-15 1
CP000453_1657 CDS_1912455-1911115 30.9 5.6e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000453_0999 1/1 413 482 .. 1 70 [] 68.0 6.5e-20
CP000453_2704 1/1 244 311 .. 1 70 [] 53.5 1.2e-15
CP000453_1657 1/1 232 301 .. 1 70 [] 30.9 5.6e-09

Alignments of top-scoring domains:
CP000453_0999: domain 1 of 1, from 413 to 482: score 68.0, E = 6.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHDs++Q+Ls +k+q+ +++ l++++ +p+++++ l e+
CP000453_0 413 ERAVIARELHDSLAQALSYMKIQVARLQGLMRKEHEPAQLEAILSEL 459

relarealaevRrllgdLRpaal<-*
r+ ++ a++++R+ll+++R + +
CP000453_0 460 RDGLNSAYEQLRELLTTFRLGMD 482

CP000453_2704: domain 1 of 1, from 244 to 311: score 53.5, E = 1.2e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD++gQ L ai+ + ++ + d++p+ +r+ +d+i
CP000453_2 244 ERHTLARELHDELGQCLVAIRADAMIIANAP--DAPPANVRASADAI 288

relarealaevRrllgdLRpaal<-*
r++a + ++ +Rr+ g+L+paal
CP000453_2 289 RQTAGHVYQLTRRIMGRLHPAAL 311

CP000453_1657: domain 1 of 1, from 232 to 301: score 30.9, E = 5.6e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpeearealde
ER I ELHD ++Q+L+a+ l + +++ ++ ++p+ +r+ l+
CP000453_1 232 ERSQITHELHDCLAQRLAALGLEVRNLEASH-GgGRAPGGLRAGLRH 277

irelarealaevRrllgdLRpaal<-*
+r+ +++a+ e+R+l g++R a +
CP000453_1 278 VRRGLDQAYGELRQLMGQFRIALE 301


Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-14 2 0|=
-13 9 0|==
-12 36 32|===*=
-11 63 262|======== *
-10 243 609|=============================== *
-9 391 691|================================================= *
-8 399 533|================================================== *
-7 419 335|=========================================*===========
-6 354 189|=======================*=====================
-5 366 101|============*=================================
-4 185 53|======*=================
-3 131 27|===*=============
-2 98 13|=*===========
-1 67 7|*========
0 34 3|*====
1 24 1|*==
2 17 0|===
3 8 0|=
4 6 0|=
5 6 0|=
6 3 0|=
> 7 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 3117.4773
P(chi-square) = 0

Total sequences searched: 2865

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: