Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

4 accessions found for Arthrobacter sp. FB24  

Data for CP000454  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000454.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000454_4109 CDS_4652434-4651100 89.5 4.4e-26 1
CP000454_4122 CDS_4671384-4670080 72.3 5e-21 1
CP000454_0484 CDS_517966-516746 63.2 2.5e-18 1
CP000454_3434 CDS_3892622-3890952 58.2 7.2e-17 1
CP000454_2114 CDS_2405863-2407560 54.6 8.5e-16 1
CP000454_3465 CDS_3930229-3928355 35.8 3e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000454_4109 1/1 220 288 .. 1 70 [] 89.5 4.4e-26
CP000454_4122 1/1 207 275 .. 1 70 [] 72.3 5e-21
CP000454_0484 1/1 208 273 .. 1 70 [] 63.2 2.5e-18
CP000454_3434 1/1 363 428 .. 1 70 [] 58.2 7.2e-17
CP000454_2114 1/1 374 439 .. 1 70 [] 54.6 8.5e-16
CP000454_3465 1/1 430 494 .. 2 70 .] 35.8 3e-10

Alignments of top-scoring domains:
CP000454_4109: domain 1 of 1, from 220 to 288: score 89.5, E = 4.4e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+v++sL+++ +++a+ ++ +k pe+a+e l+ei
CP000454_4 220 ERNRIAREMHDVVAHSLTVMLTLSDGAAVVV--RKSPERAAEVLAEI 264

relarealaevRrllgdLR.paal<-*
+++r+al ++Rr+lg+LR+++
CP000454_4 265 SRTGRTALGDMRRVLGVLRdESPA 288

CP000454_4122: domain 1 of 1, from 207 to 275: score 72.3, E = 5e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARE+HD+++Q++s+i l+ a+++ld d d + are+l+++
CP000454_4 207 ERARLAREIHDTLAQGFSSIVLMGRSAEKALD-DGDTATARERLRTM 252

relarealaevRrllgdLRpaal<-*
+e+a+ lae+R+ +++L+ +al
CP000454_4 253 QETASANLAEARNFVRGLQSPAL 275

CP000454_0484: domain 1 of 1, from 208 to 273: score 63.2, E = 2.5e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R +RE+HD+v Q+L++ l le+a r +++ +are + ++
CP000454_0 208 ERERVSREIHDTVTQGLASSLLLLEAANRSW--PAE--AAREDVLTA 250

relarealaevRrllgdLRpaal<-*
+++r+ la++R l+++L ++l
CP000454_0 251 SGMLRRNLADTRSLVHELASPGL 273

CP000454_3434: domain 1 of 1, from 363 to 428: score 58.2, E = 7.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+++ l ++ +rr + +++ a+e++ ++
CP000454_3 363 DRDRIARDLHDLVIQRLFGAGLSMQSLRRYV--PDP--VAQERISAV 405

relarealaevRrllgdLRpaal<-*
+ ++ ++ e+R+++ +R++
CP000454_3 406 TAELDSTIHELRDTIYSMRTGHG 428

CP000454_2114: domain 1 of 1, from 374 to 439: score 54.6, E = 8.5e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a+ l ++ + r + ++d a e++++i
CP000454_2 374 DRDRIARDLHDLVIQRLFAAGLSVQSLNRFT--KED--LALERIRAI 416

relarealaevRrllgdLRpaal<-*
+ ++ea++ +R+++ L+++
CP000454_2 417 TGELDEAIRSLRDTIYSLKTGNS 439

CP000454_3465: domain 1 of 1, from 430 to 494: score 35.8, E = 3e-10
*->RaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeir
R+ + R+LHD+ Q+L a+++ l +arr ++ p+e +e +d++
CP000454_3 430 RRELERDLHDGAQQRLVAVSMDLARARR----AATPAEMKELVDQAS 472

elarealaevRrllgdLRpaal<-*
+ + alae+R+l+++ p+ l
CP000454_3 473 DELAVALAELRELARGVYPPSL 494


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 5 0|=
-13 24 0|==
-12 75 46|===*==
-11 146 379|============ *
-10 501 881|======================================= *
-9 731 1001|========================================================= *
-8 650 771|================================================== *
-7 625 485|=====================================*===========
-6 461 274|=====================*==============
-5 401 147|===========*===================
-4 207 76|=====*==========
-3 120 39|==*=======
-2 79 20|=*=====
-1 46 10|*===
0 30 5|*==
1 17 2|*=
2 4 1|*
3 9 0|=
4 2 0|=
5 2 0|=
6 0 0|
7 1 0|=
8 0 0|
9 0 0|
10 1 0|=
> 11 9 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1818.9426
P(chi-square) = 0

Total sequences searched: 4146

Whole sequence top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: