Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
3 projects found  

1 accessions found for Candidatus Solibacter usitatus Ellin6076  

Data for CP000473  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000473.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000473_1251 CDS_1572404-1571349 90.3 4.9e-26 1
CP000473_2163 CDS_2809022-2806113 69.8 5.4e-20 1
CP000473_2839 CDS_3629655-3631043 66.9 3.9e-19 1
CP000473_1579 CDS_1978473-1977160 63.2 4.9e-18 1
CP000473_7743 CDS_9865917-9867275 59.5 5.9e-17 1
CP000473_7780 CDS_9910278-9909298 56.5 4.4e-16 1
CP000473_3439 CDS_4402104-4400782 55.2 1.1e-15 1
CP000473_7757 CDS_9884312-9882858 53.7 3e-15 1
CP000473_2762 CDS_3537485-3540001 53.6 3.1e-15 1
CP000473_6370 CDS_8098825-8097476 51.3 1.5e-14 1
CP000473_2657 CDS_3398822-3401749 51.0 1.9e-14 1
CP000473_7180 CDS_9142559-9141417 46.0 5.4e-13 2
CP000473_2424 CDS_3114194-3113172 32.8 4.2e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000473_1251 1/1 169 236 .. 1 70 [] 90.3 4.9e-26
CP000473_2163 1/1 769 836 .. 1 70 [] 69.8 5.4e-20
CP000473_2839 1/1 253 318 .. 1 70 [] 66.9 3.9e-19
CP000473_1579 1/1 237 305 .. 1 70 [] 63.2 4.9e-18
CP000473_7743 1/1 243 310 .. 1 70 [] 59.5 5.9e-17
CP000473_7780 1/1 120 187 .. 1 70 [] 56.5 4.4e-16
CP000473_3439 1/1 244 306 .. 5 70 .] 55.2 1.1e-15
CP000473_7757 1/1 274 338 .. 1 70 [] 53.7 3e-15
CP000473_2762 1/1 636 703 .. 1 70 [] 53.6 3.1e-15
CP000473_6370 1/1 250 311 .. 3 70 .] 51.3 1.5e-14
CP000473_2657 1/1 774 841 .. 1 70 [] 51.0 1.9e-14
CP000473_7180 1/2 177 244 .. 1 70 [] 45.0 1.1e-12
CP000473_2424 1/1 147 206 .. 9 70 .] 32.8 4.2e-09

Alignments of top-scoring domains:
CP000473_1251: domain 1 of 1, from 169 to 236: score 90.3, E = 4.9e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD +g++Ls+i l++ela rl ++ pe+a+e+++ +
CP000473_1 169 ERERIARDLHDLLGHTLSLIVLKSELASRLS--TTQPERAAEEIRDV 213

relarealaevRrllgdLRpaal<-*
++++reala+vR++++++R ++l
CP000473_1 214 ERISREALAQVRAAVRGYRSMGL 236

CP000473_2163: domain 1 of 1, from 769 to 836: score 69.8, E = 5.4e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARE+HD+++Q++ +i+ ql+++++ + ++++ +ar ld +
CP000473_2 769 ERARLAREIHDTLAQGFVGISSQLDAVAMSM--PAEATPARGYLDLA 813

relarealaevRrllgdLRpaal<-*
r++ar++l+e+Rr + dLR +al
CP000473_2 814 RRMARHSLTEARRSVMDLRASAL 836

CP000473_2839: domain 1 of 1, from 253 to 318: score 66.9, E = 3.9e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD++gQsLsai + +e+a+ + +++ + +ld i
CP000473_2 253 ERRALARELHDEIGQSLSAILMETEGAECAE--RRA--DLSSHLDSI 295

relarealaevRrllgdLRpaal<-*
++la+++ ++vR+l+ LRp+ l
CP000473_2 296 KGLAEKTVNQVRDLALLLRPSML 318

CP000473_1579: domain 1 of 1, from 237 to 305: score 63.2, E = 4.9e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ I+RELHD+vgQsL+++ l + + +l++ ++dpe +++ ++ei
CP000473_1 237 ERRSISRELHDEVGQSLTGVLLEMANLSKLIR-TRDPESVAAKAAEI 282

relarealaevRrllgdLRpaal<-*
++ ++ ++ vR+++ LRp+ l
CP000473_1 283 KREVENSIGVVRNMALLLRPSML 305

CP000473_7743: domain 1 of 1, from 243 to 310: score 59.5, E = 5.9e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ ++RELHD++gQ+L+++ + +++a+ + + p+++re+ld++
CP000473_7 243 GRRKLSRELHDEIGQTLALLQIEISRAQVAR--AGTPAALREHLDRA 287

relarealaevRrllgdLRpaal<-*
rela+++ + vR++ g LRpa l
CP000473_7 288 RELAERTVQTVRNISGLLRPALL 310

CP000473_7780: domain 1 of 1, from 120 to 187: score 56.5, E = 4.4e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ RELH +vgQ+L+ai+ qle++ + l +++p +++al++i
CP000473_7 120 ERQRLGRELHTGVGQMLAAIRWQLEVISTEL--PEPPVGVQQALQNI 164

relarealaevRrllgdLRpaal<-*
+l +++l++vR + ++L+p++
CP000473_7 165 STLTNQTLEQVRSISRRLHPPEW 187

CP000473_3439: domain 1 of 1, from 244 to 306: score 55.2, E = 1.1e-15
*->IARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeirela
I+R+LHD gQ L+ai +l++ r++ +dpe +r+ l+e++e++
CP000473_3 244 ISRDLHDDFGQILTAIGSMLQRTGRRA---ADPESVRADLREVQEIV 287

realaevRrllgdLRpaal<-*
+ +l+ vR l ++L+p +l
CP000473_3 288 QSTLDKVRTLSHALHPVIL 306

CP000473_7757: domain 1 of 1, from 274 to 338: score 53.7, E = 3e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD +QsL+ ++l+le+++ ++p+++r +l+ +
CP000473_7 274 ERRRIGRDLHDDTSQSLAWLRLHLEMLE-----SDAPAALRPRLTHA 315

relarealaevRrllgdLRpaal<-*
re ++a +e+Rr++ +L pa+
CP000473_7 316 REVTQRAVEEIRRTIAALSPAVV 338

CP000473_2762: domain 1 of 1, from 636 to 703: score 53.6, E = 3.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R AR+LHD v Q+L+++++ ++ +++ + ee+r++l+
CP000473_2 636 ERRRVARDLHDDVTQRLALLSIEIGKLATET--SGSVEEIRKRLRYF 680

relarealaevRrllgdLRpaal<-*
+ ar a +evRrl ++L+p++
CP000473_2 681 QSQARLASNEVRRLSHGLHPSVI 703

CP000473_6370: domain 1 of 1, from 250 to 311: score 51.3, E = 1.5e-14
*->aRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeire
+R + ELHD++gQsL+a+k l +++ + + + + +l+ + +
CP000473_6 250 RRFSHELHDELGQSLTAVKTNLTALAGTT--E----PQAPRLADCVH 290

larealaevRrllgdLRpaal<-*
l++ea+ vR++ + LRp++l
CP000473_6 291 LVDEAIGNVRQMSQLLRPTIL 311

CP000473_2657: domain 1 of 1, from 774 to 841: score 51.0, E = 1.9e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+v Q+ +++ +e+a + ++d + e ld++
CP000473_2 774 ERTRIAREMHDTVVQGCVGVSTLIEAAVSSA--RSDQDLMLECLDNA 818

relarealaevRrllgdLRpaal<-*
r ++r +l+e+R++l+dLR++ +
CP000473_2 819 RIHLRMTLDEARQALTDLRHDSF 841

CP000473_7180: domain 1 of 2, from 177 to 244: score 45.0, E = 1.1e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIA + HD+ Qs+ ++ + le +r+l+ ++d + l+++
CP000473_7 177 ERVRIASDFHDGPLQSFISLQMRLEILRKLM--ERDLNAGMSDLKQL 221

relarealaevRrllgdLRpaal<-*
++la++ +++R l+ +Rp +
CP000473_7 222 QALAQTQVRDLRTFLHSMRPVDV 244

CP000473_2424: domain 1 of 1, from 147 to 206: score 32.8, E = 4.2e-09
*->LHDsvgQsLsaiklqlelarrlldsdkdpeearealdeirelareal
LHDsvgQ+L+a+ lql+l+r+ + ++ +e +++ e+++l++e +
CP000473_2 147 LHDSVGQNLTALGLQLDLIRMDM--ESISPETCARAIEVQKLLEEMM 191

aevRrllgdLRpaal<-*
+ vR+ +L p++
CP000473_2 192 ESVREYSYELNPSTV 206


Histogram of all scores:
score obs exp (one = represents 24 sequences)
----- --- ---
-14 8 0|=
-13 58 1|*==
-12 136 87|===*==
-11 281 717|============ *
-10 938 1664|======================================== *
-9 1394 1889|==========================================================*
-8 1199 1456|================================================== *
-7 1134 915|======================================*=========
-6 888 518|=====================*===============
-5 788 277|===========*=====================
-4 393 145|======*==========
-3 230 74|===*======
-2 150 38|=*=====
-1 84 19|*===
0 40 9|*=
1 42 5|*=
2 25 2|*=
3 10 1|*
4 7 0|=
5 0 0|
6 3 0|=
7 2 0|=
8 2 0|=
> 9 14 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 3691.4651
P(chi-square) = 0

Total sequences searched: 7826

Whole sequence top hits:
tophits_s report:
Total hits: 13
Satisfying E cutoff: 13
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 13
Satisfying E cutoff: 13
Total memory: 25K


Acknowledgements:

This research is funded by:

Developed by: