Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Mycobacterium smegmatis str. MC2 155  

Data for CP000480  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000480.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000480_0834 CDS_937236-938204 78.4 1.3e-22 1
CP000480_4796 CDS_5065204-5066415 71.7 1.3e-20 1
CP000480_1452 CDS_1585987-1584746 67.7 1.9e-19 1
CP000480_6034 CDS_6303418-6302267 58.8 8.1e-17 1
CP000480_2721 CDS_2875590-2876747 56.6 3.6e-16 1
CP000480_3807 CDS_4010953-4009310 50.7 1.9e-14 1
CP000480_5064 CDS_5334178-5332463 48.3 9.7e-14 1
CP000480_2178 CDS_2333096-2330943 45.2 8.2e-13 1
CP000480_2712 CDS_2868002-2869096 44.0 1.8e-12 1
CP000480_0959 CDS_1053159-1051528 37.8 1.3e-10 1
CP000480_0448 CDS_534392-535687 37.3 1.7e-10 1
CP000480_3329 CDS_3517415-3516234 34.1 1.5e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000480_0834 1/1 130 194 .. 1 70 [] 78.4 1.3e-22
CP000480_4796 1/1 205 272 .. 1 70 [] 71.7 1.3e-20
CP000480_1452 1/1 205 271 .. 1 70 [] 67.7 1.9e-19
CP000480_6034 1/1 168 237 .. 1 70 [] 58.8 8.1e-17
CP000480_2721 1/1 187 254 .. 1 70 [] 56.6 3.6e-16
CP000480_3807 1/1 353 419 .. 1 70 [] 50.7 1.9e-14
CP000480_5064 1/1 380 445 .. 1 70 [] 48.3 9.7e-14
CP000480_2178 1/1 526 593 .. 1 70 [] 45.2 8.2e-13
CP000480_2712 1/1 162 229 .. 1 70 [] 44.0 1.8e-12
CP000480_0959 1/1 352 419 .. 1 70 [] 37.8 1.3e-10
CP000480_0448 1/1 234 299 .. 1 70 [] 37.3 1.7e-10
CP000480_3329 1/1 198 264 .. 1 70 [] 34.1 1.5e-09

Alignments of top-scoring domains:
CP000480_0834: domain 1 of 1, from 130 to 194: score 78.4, E = 1.3e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD++gQ+L+++ l l +a d++pe +r +l +
CP000480_0 130 ERQRIARELHDEIGQTLTVALLALKRAV-----DRAPESIRGELSDA 171

relarealaevRrllgdLRpaal<-*
+e++r +l+evR+++++LRp+al
CP000480_0 172 KEIVRSSLDEVREIARRLRPDAL 194

CP000480_4796: domain 1 of 1, from 205 to 272: score 71.7, E = 1.3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHDsv +L ++++ ++la++ l d+d ++a+e ++e+
CP000480_4 205 ERHRIERDLHDSVQPRLVSLAMTIGLAQTKL--DSDLPAAKELIAEA 249

relarealaevRrllgdLRpaal<-*
++ a+ al e+R++++++ p++l
CP000480_4 250 HDEAKNALVELRNVVRGIAPTIL 272

CP000480_1452: domain 1 of 1, from 205 to 271: score 67.7, E = 1.9e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A ++HD+++Q+L ++ l++a+r++ +dp +++e+l +
CP000480_1 205 ERRRLAADIHDGISQRLVTLSYRLDAAARAA---DDPRAVAEQLGKA 248

relarealaevRrllgdLRpaal<-*
rela+ +l+e+R+++++LRp++l
CP000480_1 249 RELADLTLQEARAAISGLRPPVL 271

CP000480_6034: domain 1 of 1, from 168 to 237: score 58.8, E = 8.1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RIARELHDsv+Q+ ++ +q+e++r + + p+++ + ++ld
CP000480_6 168 ERHRIARELHDSVSQTVLSAGMQIEVCRSEA--MALPGtqDLVDRLD 212

eirelarealaevRrllgdLRpaal<-*
++++l r a +++R ++ +L ++++
CP000480_6 213 TAKTLTRSASEQLRSAIYALNHPED 237

CP000480_2721: domain 1 of 1, from 187 to 254: score 56.6, E = 3.6e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IAR+LHD+++++ sa+ +++++ar +l +dp+++++ l+++
CP000480_2 187 EREAIARDLHDVISHHVSAVGIHAGAARLAL--GTDPDAVARSLAAV 231

relarealaevRrllgdLRpaal<-*
+ ++r a+ ++Rr l L+ a+
CP000480_2 232 ESASRSAMMDLRRQLDLLHGADS 254

CP000480_3807: domain 1 of 1, from 353 to 419: score 50.7, E = 1.9e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+RIAR+LHD v Q+L+++ + l++ +++ ++d ++e+l +
CP000480_3 353 DRERIARDLHDHVIQRLFLAGMDLQGTIART--KSD--LLKERLSRT 395

relarealaevRrllgdLR.paal<-*
+ ++ ++e+R ++ dL++paa
CP000480_3 396 VDDLQSIIDEIRTAIFDLQsPAAS 419

CP000480_5064: domain 1 of 1, from 380 to 445: score 48.3, E = 9.7e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a+ l l++ ++ +++ e++++++ +
CP000480_5 380 DRDRIARDLHDHVIQRLFAVGLSLQGTIPRA--RSA--EVQQRIADC 422

relarealaevRrllgdLRpaal<-*
+ ++ ++e+R ++ dL+++a
CP000480_5 423 VDDLQAVISEIRTAIFDLHHTAP 445

CP000480_2178: domain 1 of 1, from 526 to 593: score 45.2, E = 8.2e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+R R+LHD+ Q++ ++ l l ++++ + ++++ ++++++ +
CP000480_2 526 ARRRFERDLHDGAQQRIVSLGLELRAVQASV--PDENTALQDQMSHV 570

relarealaevRrllgdLRpaal<-*
+ + +a++ +l ++++pa+l
CP000480_2 571 VDGLAGLYADLQELSRGIHPAIL 593

CP000480_2712: domain 1 of 1, from 162 to 229: score 44.0, E = 1.8e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IAR+LHD+ Q++ + l l+l r ++ +++ e+++ l +
CP000480_2 162 ARRQIARDLHDGAQQRMLNVLLALQLTREHV--PSELEALDSMLMDA 206

relarealaevRrllgdLRpaal<-*
++ ar+a++e+R+l+ +++p++l
CP000480_2 207 MAEARHAITELRDLAAGIHPTIL 229

CP000480_0959: domain 1 of 1, from 352 to 419: score 37.8, E = 1.3e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+R R+LHD+ Q+ ++ l+l ++++ + ++d e+r ++ ++
CP000480_0 352 ARRRFERDLHDGAQQRVISLGLGLRAVEASV--PDDQLELRLQISRV 396

relarealaevRrllgdLRpaal<-*
+ ++ +e+ + ++++pa+l
CP000480_0 397 VDGLSSLSTELQEFSRGIHPAIL 419

CP000480_0448: domain 1 of 1, from 234 to 299: score 37.3, E = 1.7e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+R+ R++HD+ Q+L +++ l++ar+ ++ p+++++ +de+
CP000480_0 234 ALRRLERDIHDGPQQRLIRLAMDLGRARQ----HTQPGALQDIIDEA 276

relarealaevRrllgdLRpaal<-*
+e+l+e+R+l +++ p++l
CP000480_0 277 VVQTQETLDELRALSRGIAPPVL 299

CP000480_3329: domain 1 of 1, from 198 to 264: score 34.1, E = 1.5e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrllds..dkdpeeareald
R+R+ R+LHD+ Q+L +++l + ++ d ++ +d +r +l+
CP000480_3 198 ARKRLERDLHDGAQQHLVSLALRVAMLS---DCpgVSD--SIRNQLK 239

eirelarealaevRrllgdLRpaal<-*
e+ +++ + ++R+l+++++pa+l
CP000480_3 240 ELSIGLDTVIGDLRELARGIHPAIL 264


Histogram of all scores:
score obs exp (one = represents 20 sequences)
----- --- ---
-14 20 0|=
-13 85 0|=====
-12 146 75|===*====
-11 216 615|=========== *
-10 726 1428|===================================== *
-9 1129 1621|========================================================= *
-8 971 1249|================================================= *
-7 976 785|=======================================*=========
-6 803 444|======================*==================
-5 720 238|===========*========================
-4 330 124|======*==========
-3 221 64|===*========
-2 130 32|=*=====
-1 75 16|*===
0 65 8|*===
1 25 4|*=
2 23 2|*=
3 15 1|*
4 5 0|=
5 8 0|=
6 4 0|=
7 2 0|=
8 3 0|=
9 1 0|=
10 2 0|=
> 11 15 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 3784.3721
P(chi-square) = 0

Total sequences searched: 6716

Whole sequence top hits:
tophits_s report:
Total hits: 12
Satisfying E cutoff: 12
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 12
Satisfying E cutoff: 12
Total memory: 25K


Acknowledgements:

This research is funded by:

Developed by: