hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000481.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000481_0556 CDS_591357-592829 104.0 1.1e-29 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000481_0556 1/1 295 367 .. 1 79 [. 104.0 1.1e-29
Alignments of top-scoring domains:
CP000481_0556: domain 1 of 1, from 295 to 367: score 104.0, E = 1.1e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ++++LLrLQar+ +e+ ++aL+E+++RV++
CP000481_0 295 EIHHRVKNNLQTVAALLRLQARRLAVPEA-----QAALEEAVRRVRA 336
mAliHEeLYksedldtvdfseYlekLtenLfq<-*
+Al+HE L+ + d + v+f+e+ + L++ ++
CP000481_0 337 IALVHETLSHTLD-GPVNFDEVADQLLAMVRD 367
Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-15 1 0|=
-14 7 0|=
-13 35 13|=*==
-12 112 141|=========== *
-11 600 394|===================================*===================
-10 493 510|============================================= *
-9 326 431|============================== *
-8 280 289|==========================*
-7 108 171|========== *
-6 112 95|========*==
-5 30 51|=== *
-4 28 27|==*
-3 11 14|=*
-2 6 7|*
-1 4 3|*
0 2 2|*
> 1 2 -|=
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 210.5899
P(chi-square) = 8.889e-309
Total sequences searched: 2157
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K