Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

3 accessions found for Pelobacter propionicus DSM 2379  

Data for CP000482  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000482.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000482_2966 CDS_3287726-3286260 167.4 1.4e-47 1
CP000482_2965 CDS_3286248-3283897 161.0 1.1e-45 1
CP000482_1939 CDS_2114658-2117105 153.8 1.3e-43 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000482_2966 1/1 276 362 .. 1 94 [] 167.4 1.4e-47
CP000482_2965 1/1 587 673 .. 1 94 [] 161.0 1.1e-45
CP000482_1939 1/1 619 705 .. 1 94 [] 153.8 1.3e-43

Alignments of top-scoring domains:
CP000482_2966: domain 1 of 1, from 276 to 362: score 167.4, E = 1.4e-47
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ++S LL+LQ+++++de l ++Esq+R+ S
CP000482_2 276 EIHHRVKNNLQIVSTLLDLQSDYIDDEQS-----LRYFQESQDRINS 317

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE LY+s+dl ++df Yle Lt++Lf+sy v+ ++isLk +
CP000482_2 318 MALVHEALYRSRDLARIDFTVYLEGLTDHLFKSYVVDPKRISLK--C 362

CP000482_2965: domain 1 of 1, from 587 to 673: score 161.0, E = 1.1e-45
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+IS LL+LQa++++de + l a+rEsq+R+++
CP000482_2 587 EIHHRVKNNLQIISTLLDLQAESVRDEGA-----LCAFRESQDRIRA 628

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE+LY++edl+ +dfs Y+e Lt++L +sy+ + +++s++ +
CP000482_2 629 MALVHEKLYRTEDLSFIDFSGYIESLTAHLYNSYAIDFGRVSFS--I 673

CP000482_1939: domain 1 of 1, from 619 to 705: score 153.8, E = 1.3e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNN+Q+ISSLL LQ++++ de + + LrEsqnRV+S
CP000482_1 619 EVHHRVKNNMQIISSLLELQSDSIVDERT-----RSCLRESQNRVRS 660

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+s+d++ +d++eY++ L +Lf++y v+s++isL+ +
CP000482_1 661 MALIHERLYRSKDFSAIDVGEYVRDLSQYLFDAYVVDSERISLN--I 705


Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-15 1 0|=
-14 8 0|=
-13 43 22|=*=
-12 189 234|============= *
-11 885 654|===========================================*===============
-10 750 846|================================================== *
-9 607 714|========================================= *
-8 431 479|============================= *
-7 238 284|================ *
-6 231 158|==========*=====
-5 79 85|=====*
-4 55 45|==*=
-3 23 23|=*
-2 14 12|*
-1 14 6|*
0 3 3|*
1 1 1|*
> 2 4 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 193.9908
P(chi-square) = 5.659e-35

Total sequences searched: 3576

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: